tg0009

Coordinates:10951-11877

>tg0009 moxR-type AAA ATPase, putative chaperone protein (moxR)
MIEMIIEKIRTEVKKAIVGMDDVVELMTIALLSNGHILLEGVPGLAKTTLSKNFAKSLNLAFTRVQMTPDLLPADIIGHS
FYDMRTGEFKIRKGPIFTNILLVDEINRASPKTQSALLEAMEEKQVTIEGQTFRLPRPFLVIATRNPVEIEGVYDIPTAQ
ADRFMMEIKVSYLSENHEKEMLRRKNLGLFDEAKPVVSKGELEKAAKEVRGVKVSDEIIDYIYSILRATREDERALLGAS
PRAGEHLLLAAKAKAYLENRSYVIPDDVKSLAVPVLSHRILIKPEYEMEGLTGEEVVREALNRVEVPTG

>tg0009 moxR-type AAA ATPase, putative chaperone protein (moxR)
gtgattgaaatgataatcgagaagattaggacagaggtgaaaaaggccatagtaggcatggacgacgtcgtcgagctcat
gacgatagcgctcctctcaaacggtcacatcctcctagagggtgtcccggggctggcaaagacgacgctgagcaagaact
tcgcgaagagcctgaacttggcctttacaagagtacagatgacacccgatctcctcccggcggacataatagggcacagc
ttctacgacatgaggacgggcgagttcaaaataaggaaggggccgatattcacgaacattcttctagttgacgaaataaa
cagggcctcgccgaagacccagtctgcccttcttgaggccatggaggaaaagcaggtgactatagagggccagaccttca
gactccccaggccattccttgtcatagccaccagaaatcccgttgaaattgagggggtctacgatatacccaccgcgcag
gcggacaggtttatgatggagataaaggtctcctacctcagcgagaaccacgagaaagagatgctcagaagaaagaacct
gggactgttcgacgaggcgaagcctgtagtctccaaaggagagctcgaaaaggcggcaaaagaagtcaggggagttaagg
tcagcgacgagataatagactacatctactcaatcctgagggcaacgagggaagacgagagggctctcctgggggcctcg
cccagggcgggagagcacctcctcctagcggccaaggcgaaggcctatctggaaaacagaagttacgttataccagacga
cgttaaaagcttggccgtcccggttctctcccataggattctgataaagccagaatacgaaatggaaggcctgaccggag
aggaagtggtcagggaagccctcaacagggtagaggtgccgactgga


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 10451 - 12377 (Additional range around tg0009 is :500nt.)

>Thermococcus gammatolerans EJ3 CCCGTCGGCAATAATAGTCACCAGGAAGGGAGAGGTTTACACGAGCGGAACCGCCATGATAAATTTCCACAGAAGGACGT ACCCGATTCTAGCCATGACGAGGTACGGAAAGGGCAGAATAATAGTCCTCGCAGATCCAGACATACTGAGCAACAACCTC TTCGAAGAAAACTACCCCTTCCTGAGGAACCTAATCAACTACATCCCCGGCCCGGTTTACATCGATGAGAGCCACCACAG CGACTTCAACCTTTACACCCAGGGGACGATAACGATAAGAAGGGTCCTCCCGAAGGAGAGTGCGCAGAAGCTCCTCCTTC TGCTGGGGTTCCTGATTATAGCCTATGAGTTCGGGGCGCTTGGATACCTGGGAAGACCCCTCAGGATGGTGATCGAAAAG ATTATTGGAAGAAGGGGCTCCATTGAGGAGGTGGCCCTTGAGCTCGCAGAGGAGAGGGGATGGGATAAAAAGGAAGTGCT CGAAATGCTGAACAGTCTGG gtgattgaaatgataatcgagaagattaggacagaggtgaaaaaggccatagtaggcat ggacgacgtcgtcgagctcatgacgatagcgctcctctcaaacggtcacatcctcctagagggtgtcccggggctggcaa agacgacgctgagcaagaacttcgcgaagagcctgaacttggcctttacaagagtacagatgacacccgatctcctcccg gcggacataatagggcacagcttctacgacatgaggacgggcgagttcaaaataaggaaggggccgatattcacgaacat tcttctagttgacgaaataaacagggcctcgccgaagacccagtctgcccttcttgaggccatggaggaaaagcaggtga ctatagagggccagaccttcagactccccaggccattccttgtcatagccaccagaaatcccgttgaaattgagggggtc tacgatatacccaccgcgcaggcggacaggtttatgatggagataaaggtctcctacctcagcgagaaccacgagaaaga gatgctcagaagaaagaacctgggactgttcgacgaggcgaagcctgtagtctccaaaggagagctcgaaaaggcggcaa aagaagtcaggggagttaaggtcagcgacgagataatagactacatctactcaatcctgagggcaacgagggaagacgag agggctctcctgggggcctcgcccagggcgggagagcacctcctcctagcggccaaggcgaaggcctatctggaaaacag aagttacgttataccagacgacgttaaaagcttggccgtcccggttctctcccataggattctgataaagccagaatacg aaatggaaggcctgaccggagaggaagtggtcagggaagccctcaacagggtagaggtgccgactgga TGAAGACCGCC GATTTCCTCCTCGGCCTCGCGGGGGTTCTCCTGGCTGGAGCGATCCTTCTTCAAAGCCCCTCACTGGCCGGAATCGCCTC GGCGATAATGGCCTACTACGCCTCGGTCAGGCTGTCCTTCAAGGGCGGCGGAAAGGCCGTATTAACCCTCCCCGAGAGAA CTACGGAACTCGAGTGGACCAAGATCCCGGTCGAGGTAGAGTCGAGGTTCGAGATCCCTGGTAGAATTGTCGTAAACGTC AGGAACCCGGACGTAGAGGTCGAAGAATTCTCCATGGAGATAAAGCCCGGAGAGAACTCAAAAACCGCCCTCAGGATAAA GCCTTTGAAGAAAGGAATGCTTGACGTGGAAATTGAGGCGTTCTTTATGGACAAATCGGGCCTGTTCATGAAAAAGATAG ACGTCGAAGGGATCAAACCCATAGCTGTTCTCCCCTCGCCGAGGAAAGTTGCGGAGGCACGGAGGGTAAGGGAGAAACCA AACGCCTT