tg0012

Coordinates:13693-14529

>tg0012 hypothetical protein TGAM_0012
MKLKPVKIRTFEGLVVIITTAVFLLYRTPFTLYAGLLYALTLYASERKALPRDPGLDPQTILGILLVLLSPVFLVVKLGK
YPSPSTFVMLFLLGLQLVFFRIKGLEMPLAVAAGGAAVALSSKTGLIRKVIDITSGLFVDVTSILVKGLVELSGIPIKIN
KNIAVVGKAIVIIGSGCSGFDAFVIYILASLLLIYMRKSSRREAALLLLGAVGIIPLNALRIFILLVIGYYTGVSFLELF
HSHLGDLMFVAYVFLYWWWVTGRKKRTSVALESKGQNDQ

>tg0012 hypothetical protein TGAM_0012
gtgaaattgaaaccggtaaaaatcaggacgtttgaggggctcgtcgtgatcatcacgacggcagttttccttctttacag
gactccgttcacgctctacgccggcctgctttacgccctaaccctctacgcctcggagagaaaggccctcccaagggatc
ccgggctcgacccccagacgatcctcgggattttgctcgttctactctcaccggtgttcctcgtagttaagctgggaaag
tatcccagcccctcgaccttcgtcatgctcttccttctgggcctccagctagttttcttcaggataaaaggccttgagat
gcccctggccgtggcggctggcggagctgccgtagcgctctcatccaagactggattaatcagaaaggtgatagacataa
caagcggactcttcgtggacgtcacctcgatactggtcaaggggctggtagagctctccgggattccgataaagatcaac
aaaaacatcgcagttgtgggaaaggccatcgtgataatcggctcgggctgttccggctttgacgccttcgtcatctacat
cctggcctccttgcttctgatctacatgaggaaatcctccagaagggaggcggcccttctgctcctcggggcggtaggaa
tcatcccgctcaacgccctgaggatattcatcctcctggtcatcggctactacacaggggtttcgtttctggaactgttc
cactcccacctgggggatctcatgttcgtcgcctacgtgttcctctactggtggtgggttacgggaagaaaaaagagaac
atcagtggcgcttgaaagcaaaggccaaaacgaccag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 13193 - 15029 (Additional range around tg0012 is :500nt.)

>Thermococcus gammatolerans EJ3 CTGAAATCCTGGATCCCGCTGACGGCGGCCCTAGCTTACATTCTCTCCATAAAGGGGAGGAAAACAGCCCTCCTGGGCTT CTCCCTATACCTCACCTCCATCATAGCCGACCCCGGCTTCGACTCTGTGTACACGATAAAAGGCCAGAAGGAGTTTATCC TCCTGGGAATGACGACACTCCTAGTCCTCAACGACGTCCTACAGAGGGGAATACTGACGGAGAATAAATGGGACATCCCC CTGAGTGGAGTCCTAGCAATCTCAGCAGTCAATGACTACACGCTGTTCGCAGCTCTTATCAGCACGGCCGTTTACAAGCT CTATGAAAGCTTCGGGAAAGCGGCCCTGTACTTCCTCACCTGGCTCTCCACAATGGGAATAGTACTCCTCGCCCTCAAAG GGAAGCTTCCTGGAATCGCCGCAGAGACTTTCGTTATAGGCGCCCTCGGCCTCTTGGCAGTTGTTGTAGGAGGTATCAGA GACATTAACCACGCGGAGGT gtgaaattgaaaccggtaaaaatcaggacgtttgaggggctcgtcgtgatcatcacgac ggcagttttccttctttacaggactccgttcacgctctacgccggcctgctttacgccctaaccctctacgcctcggaga gaaaggccctcccaagggatcccgggctcgacccccagacgatcctcgggattttgctcgttctactctcaccggtgttc ctcgtagttaagctgggaaagtatcccagcccctcgaccttcgtcatgctcttccttctgggcctccagctagttttctt caggataaaaggccttgagatgcccctggccgtggcggctggcggagctgccgtagcgctctcatccaagactggattaa tcagaaaggtgatagacataacaagcggactcttcgtggacgtcacctcgatactggtcaaggggctggtagagctctcc gggattccgataaagatcaacaaaaacatcgcagttgtgggaaaggccatcgtgataatcggctcgggctgttccggctt tgacgccttcgtcatctacatcctggcctccttgcttctgatctacatgaggaaatcctccagaagggaggcggcccttc tgctcctcggggcggtaggaatcatcccgctcaacgccctgaggatattcatcctcctggtcatcggctactacacaggg gtttcgtttctggaactgttccactcccacctgggggatctcatgttcgtcgcctacgtgttcctctactggtggtgggt tacgggaagaaaaaagagaacatcagtggcgcttgaaagcaaaggccaaaacgaccag TAAAGCCCCCACTATCAAGGG GGAATATCCAAAGAAGAGCACGGCAGTCAGGTCAACGTCTGCCGCATAGTCTATGCTACCGTCGCTGAGTTCCCCGTCAG TTGATGACGGGCTCATGAGGTCAACTACCTTCGGTGAGCCGGGATCGAGGGCACCTCCCCTGCTGTCTCCAAGGAAGACC AGGACGTTAAAGCCCAAGCTCGATGGGTTGCCGAGGAGTTCCCTGGGAATCGCCACCTGGATCACGCTATTGGTTTTGGA GGCTATAGCGTAGTAGTCCCCAGCCAGCTTGGAGAATGAGGAATCATAAACCTCCACCGCAGGAGAACCAAGTATCTCAG TATCTGGAAAGCCTGCCTTGGAGAGATCAACGACCACCCAGTAGTCCCAGCCGGGGGAATAGCTCAGAGAGCCGTCGTAT GGAATGGTGTGGTTAGTCCCAGTGCCGACGCTTATCGGGATTGCGATGAGAGGAGCCCCAAACTCTCCAATGGAAGCC