tg0021

Coordinates:25887-26078

>tg0021 hypothetical protein TGAM_0021
MIIETAIPFEELEEIRRKSGAEVKLTLLGTIERNGIVLNRVLVEGHPEEIERFMGKLKLARAGG

>tg0021 hypothetical protein TGAM_0021
ttgattatcgagacggccattccctttgaggagcttgaggagataaggcgaaagagcggggcagaggtcaagctgactct
tctcggaaccatcgagaggaacgggatagtcctcaatcgggttctcgtggaaggccatccagaggaaatcgagcgcttca
tggggaagcttaagctcgcgagagccggcggt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 25387 - 26578 (Additional range around tg0021 is :500nt.)

>Thermococcus gammatolerans EJ3 GTGGAGACATAGCGAGACTGGGAAGAACGGGCCCCTATTACGAGGAAATCCACCCGGAGCTCGTCCCGAGGATAAAGCCC CTCCGCGAGATTCCGGAGAAGGAGATAGTGCTATACGCGGTCCTGAACAACATTGAGGTTGACCTGAGCGAGTGCCCCTA CGCGGTCGAGGCCTTCCGAGCCGAAATCCGCGACTGGCTCAACGAGATGGAGGAGAGACACCCGGGAACGAAGTACCAGA TACTCAGGAGCTACGACAAGCTCTTCCCGCTAATAGCGAAGACCTACACGAAGAAAACCAGCGAGCTGAACCGCTGTAAG ATATGTGGCCAGCCGACGACGGGGGAGATATGCAAGGCCTGCCAGTTCCGCCTTCAGGTCGAGAGGAAGGCGAGGGAAAA GGGCCTGACGTTCAGGGTTGAGTAAACTGAACAGCTATTTATAAAGACCTGTTTAGTATACTGAACAACTTGTCTTGTTA AACTTCACCAGGTGTTCCCC ttgattatcgagacggccattccctttgaggagcttgaggagataaggcgaaagagcgg ggcagaggtcaagctgactcttctcggaaccatcgagaggaacgggatagtcctcaatcgggttctcgtggaaggccatc cagaggaaatcgagcgcttcatggggaagcttaagctcgcgagagccggcggt TAGTTTGCGCCCCAAACTTCCGGGCG GGTATTTAAAGGCTCACTCAAACTTTTCCCGGTGGGAGCATGGAGGAACTTAGTGAAGCTCTAAAGGCCATCGAGAGGGA GCTCAACTTCGCGAAGAAGGCGTATAGAGCGAGCGTTTTCCTCTACTGGGCGTGGGCGATGCCCGGGGTTTACCTCCTCG CACAAATCCTGTTAAAGTACGCCGGGATTGGTGAAGGAAGCGCCATCCAGTGGCTTTCGCTGGCAGCAGTCGTGGGCTTC ATCGTCGAAGAGAGAAAGACCTTCAGAAGGGTTATTCAGCTGGAAGAGGCCCTGGAGCACATTGAGGAAACGCCCAGGGG TTACGTTCTTGCCCAGGTTATCGTGTGGCCTCTCTCGGCCCTGATTGCCAGCATGTACACCGAGAATGATGGCCTGTGGA TGCTGGTCTTCATCGGGCTCGGCCTGCTCCTCCTGACGGGCGTTGAGTTCATCTTCACTGGAAAAAGGGACTG