tg0022

Coordinates:26144-26710

>tg0022 hypothetical protein TGAM_0022
MEELSEALKAIERELNFAKKAYRASVFLYWAWAMPGVYLLAQILLKYAGIGEGSAIQWLSLAAVVGFIVEERKTFRRVIQ
LEEALEHIEETPRGYVLAQVIVWPLSALIASMYTENDGLWMLVFIGLGLLLLTGVEFIFTGKRDWKTALAGVILLSSTAL
CTGFGYAVMAVAFAFSLTAYLHLKGAMRE

>tg0022 hypothetical protein TGAM_0022
atggaggaacttagtgaagctctaaaggccatcgagagggagctcaacttcgcgaagaaggcgtatagagcgagcgtttt
cctctactgggcgtgggcgatgcccggggtttacctcctcgcacaaatcctgttaaagtacgccgggattggtgaaggaa
gcgccatccagtggctttcgctggcagcagtcgtgggcttcatcgtcgaagagagaaagaccttcagaagggttattcag
ctggaagaggccctggagcacattgaggaaacgcccaggggttacgttcttgcccaggttatcgtgtggcctctctcggc
cctgattgccagcatgtacaccgagaatgatggcctgtggatgctggtcttcatcgggctcggcctgctcctcctgacgg
gcgttgagttcatcttcactggaaaaagggactggaagacagcgctggcaggggtgatactgctctcctcgacggctctc
tgcacgggctttggctacgccgtgatggccgttgcattcgcattctcgctcacggcttaccttcacctgaagggggcaat
gagggag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 25644 - 27210 (Additional range around tg0022 is :500nt.)

>Thermococcus gammatolerans EJ3 AAGCTCTTCCCGCTAATAGCGAAGACCTACACGAAGAAAACCAGCGAGCTGAACCGCTGTAAGATATGTGGCCAGCCGAC GACGGGGGAGATATGCAAGGCCTGCCAGTTCCGCCTTCAGGTCGAGAGGAAGGCGAGGGAAAAGGGCCTGACGTTCAGGG TTGAGTAAACTGAACAGCTATTTATAAAGACCTGTTTAGTATACTGAACAACTTGTCTTGTTAAACTTCACCAGGTGTTC CCCTTGATTATCGAGACGGCCATTCCCTTTGAGGAGCTTGAGGAGATAAGGCGAAAGAGCGGGGCAGAGGTCAAGCTGAC TCTTCTCGGAACCATCGAGAGGAACGGGATAGTCCTCAATCGGGTTCTCGTGGAAGGCCATCCAGAGGAAATCGAGCGCT TCATGGGGAAGCTTAAGCTCGCGAGAGCCGGCGGTTAGTTTGCGCCCCAAACTTCCGGGCGGGTATTTAAAGGCTCACTC AAACTTTTCCCGGTGGGAGC atggaggaacttagtgaagctctaaaggccatcgagagggagctcaacttcgcgaagaa ggcgtatagagcgagcgttttcctctactgggcgtgggcgatgcccggggtttacctcctcgcacaaatcctgttaaagt acgccgggattggtgaaggaagcgccatccagtggctttcgctggcagcagtcgtgggcttcatcgtcgaagagagaaag accttcagaagggttattcagctggaagaggccctggagcacattgaggaaacgcccaggggttacgttcttgcccaggt tatcgtgtggcctctctcggccctgattgccagcatgtacaccgagaatgatggcctgtggatgctggtcttcatcgggc tcggcctgctcctcctgacgggcgttgagttcatcttcactggaaaaagggactggaagacagcgctggcaggggtgata ctgctctcctcgacggctctctgcacgggctttggctacgccgtgatggccgttgcattcgcattctcgctcacggctta ccttcacctgaagggggcaatgagggag TAACATGCTCGAAGAACTGGCGAGGCTCTCAAGGTCTCCGCTCGGCAATCC GACGAGGTTAGCCATAGCGCTCTACCTGCTGTCGAGGGAAAGGGCGACCTTCGTGAGCCTGAGAAAAGCCTTGAAGCTCA CCGCCGGAAACCTTGAATTTCACCTGAAGACGCTTGAGGAGGCCGGAATCGTTAGGACGTACTACGGCTTCGGGAGGAGG CCGAGGAAGTTCGTCGAAATAACCGAAGAGGGAATTGAAGAGCTCAGGGAAGTCCTCAAAATCCTGCGGGAGGTGACCGG GGATGATTGAGTTCGCGGTTGCCCTTACCCTGTGGCTGTTGATTTTATCCGCTTCAGGGACCGTTGCCACCCTGGTCGCC GGGAGATGGGCGAAAAAGGCCGGCTTCGCGATGCAACTGACGATGTTTTTCCTCTCGCTTGCGGTGATCGAGCTCATGGG CGGGCCCCAGAGGTTTGGACTCGTTCCCGATTTCAGATACGTTCCCCA