tg0026

Coordinates:28551-29168

>tg0026 hypothetical protein TGAM_0026
MEEVSELKSVLERVEGRLIAAGKMYGAMNFAVWLAIMLLYYVMLGIFDISWQFNLIYWPLGFAVAMVFTGRIWKRLKRLG
RVTGREIESSPLAGILIGLSWATGIVLGWVIVPDLNPGITEEASLATGFLTFIAFSVFAMWLVMAGFSPKNGEREIIPAF
LIPALGILRSTGMAEGAIAWAGFVVGLGFSLTVLWYLYSAFKAIER

>tg0026 hypothetical protein TGAM_0026
atggaggaggttagcgaactgaagagtgtccttgagcgtgtggagggcaggctgatagccgctggaaagatgtacggggc
gatgaacttcgcggtgtggctggccataatgctcctgtactacgtcatgctgggcatctttgatatttcctggcagttca
atctaatctactggccgctgggctttgccgttgcaatggtcttcacggggagaatctggaagagacttaaaaggctcgga
agggttacaggaagggagatcgagagctctcccctcgcggggatcctcataggactctcctgggcaaccggcatcgtact
cggctgggtcatcgttccagacctgaaccccggcatcacggaggaggccagcctcgcaaccggcttccttaccttcatag
ccttttcagtcttcgcaatgtggctcgttatggcgggctttagccccaaaaacggcgagcgcgagataatccccgcgttc
ctgatcccggcactcgggatactacgttccaccggcatggcagagggagctatagcctgggccggcttcgtcgtcggact
ggggttttcgctcaccgtgctctggtacctctattcagcattcaaagcaatcgagcgg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 28051 - 29668 (Additional range around tg0026 is :500nt.)

>Thermococcus gammatolerans EJ3 TCATCTATGGTCGGGTCAGTGTAAACGTAATCCTCCGAGTACTTGAGGCCGTAGAAGGAGGAGAATATGTCCACGACCGC GAGGTCTCCCCTTCTTCCGAGCTCGTCGATATCGAAGTTTACAGCCCTGAGCTCCATACGGAGGGGTGTAATCGGAAGAA CTGAATCGAGGATGACGCCAAAGTCACCCATACCTATCCTGCGCCGCACTATCTCAAAACCGAGCGCCCACCCCCGCGAG TACGTCGTGTAAATTATCAGGAGATTGCTGTCCTCGAGGAGACCCCCTCCAAGGGCCTCGTCGAGCAGAGGAATACCTGT GCTCAGCAATTCCACACCCAATCACCAATTTGATGATCATGCATTAAAGTATTTAACACTAACTCCCCAAAGTGTTCAAA GAAAGGCCTCTCTGATAGTACTCGTAAACCATTGTGCTCTGAGATTCAGAGAAACAATCGGCTAAATAAGCGGTCAGCGT AACATCCAATGGTGAGGAAA atggaggaggttagcgaactgaagagtgtccttgagcgtgtggagggcaggctgatagc cgctggaaagatgtacggggcgatgaacttcgcggtgtggctggccataatgctcctgtactacgtcatgctgggcatct ttgatatttcctggcagttcaatctaatctactggccgctgggctttgccgttgcaatggtcttcacggggagaatctgg aagagacttaaaaggctcggaagggttacaggaagggagatcgagagctctcccctcgcggggatcctcataggactctc ctgggcaaccggcatcgtactcggctgggtcatcgttccagacctgaaccccggcatcacggaggaggccagcctcgcaa ccggcttccttaccttcatagccttttcagtcttcgcaatgtggctcgttatggcgggctttagccccaaaaacggcgag cgcgagataatccccgcgttcctgatcccggcactcgggatactacgttccaccggcatggcagagggagctatagcctg ggccggcttcgtcgtcggactggggttttcgctcaccgtgctctggtacctctattcagcattcaaagcaatcgagcgg TGATAGGATGGAATCGCTCAGGGAGCTCACGAGAAACCACTTCCTCGGGAACCCGATAAGGTTAGGGATCATGCTCTACC TCCTGCCAAGGGGAAAAGTTCTCTTCAAGGAACTCCTCGGAGTTCTTGAGGTAACCCCCGGAAACCTCGACTCCCATCTA AGAACCCTCGAAAAAGCGGGCTACGTAAAGCTTTACAAGGTCTTCGCCGACAGGCCGAGAACGGCGGTAAGGATAACGGA GAAGGGGGCGGAAGAGACGGCGAGGTACCTGAGGGCCCTCAAAAGCGTGCTTGAGGGGATGGGATGATCACATCGCTTAA TCGCTCAAGGAGAACGGATAATCCCTCCTCCCGACCATCCAGAGCCCGAAGAGCGCCCCGAGGGTGTCCATGAGCAGGTC TCGCAACTTGTTAGCGGTGCTCTCCGCTATGAAACCAATCCAGCTCTCACTCAGCTTTTCCGCAATCTCCCAGCCGAGCG ATAACCCGTAAAAGACCAC