tg0039

Coordinates:38851-39204

>tg0039 membrane bound hydrogenase, MbhI subunit (MbhI)
MREMFGYWDALYFVLVFIVGLILAYLLDKWAKRSGMGTREVGDGTKIFISGEDPEKVIPGFEHFEGSYTGRNVMWGLTYA
LKRFFTALRGEHTGLLTDYVSYLIITTAFVMVVLLIWG

>tg0039 membrane bound hydrogenase, MbhI subunit (MbhI)
gtgcgtgaaatgttcggctactgggatgcgctctacttcgtcctcgttttcatcgtcggactcatcctggcttacctcct
cgacaagtgggcgaagaggagcggaatggggacgagggaagttggcgacgggacgaagatattcatcagcggtgaggacc
ccgagaaggttattccgggcttcgagcactttgagggcagctacaccggcaggaacgtcatgtggggactaacatacgcg
ctcaagcgcttcttcacggccctcagaggggagcacacaggactgctcacggattacgtgagctacctgataataacgac
cgccttcgtgatggtggtattgctcatctggggg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 38351 - 39704 (Additional range around tg0039 is :500nt.)

>Thermococcus gammatolerans EJ3 GCGATTTACCACACCTTCAACCACGCACTCATGAAGGCGCTCCTCTTCCTGATTGCAGGAGTCGTAATCCACGAGCTCGG CACGAGGGACCTGAACGAGCTGAGCGGTTTAGCTAAGACAATGCCGAAAACAACCTTCGCCTTCCTCATAGGAGCGGCCG CAATAGTGGGAATGCCACCCCTCAACGGCTTCGCGAGCAAGTGGCTCATCTACGAGAGCTCGGCCATATTCAACCCGATA CTCGGCGCGATAGCGATAATCGGAACGGCATTCTGTACGGCAGCATACGTCAGGGTTCTCTACACCTTCTTCGGAAGGCC CAGCGAGAGGGTCATGAAGGCCAGAGACCCCGAGGCGAGCATGCTCTGGCCGATAATAATCCTCGCGGTCGCGATAGTCA TCATGGGGCTCTTCCCCTGGCAGATAAGCGAGAAGATCATGCTTCCAGCGGTCAAAGCCCTTGAGGACCAGCTGGCCTAC ATAAGCGCTGTCTTAGGAG gtgcgtgaaatgttcggctactgggatgcgctctacttcgtcctcgttttcatcgtcgga ctcatcctggcttacctcctcgacaagtgggcgaagaggagcggaatggggacgagggaagttggcgacgggacgaagat attcatcagcggtgaggaccccgagaaggttattccgggcttcgagcactttgagggcagctacaccggcaggaacgtca tgtggggactaacatacgcgctcaagcgcttcttcacggccctcagaggggagcacacaggactgctcacggattacgtg agctacctgataataacgaccgccttcgtgatggtggtattgctcatctggggg TGAGATGGAATGGCGATAACAGTTC CCGCCAACAACGGTTCAAACTCATCGGAGCGCGAGAGGCTTGAAAAGAGAATCGCCCAGCTGTGCCGCTACATAGGGAGG TCGCCCTGGGTCTTCCACGTGAACACCGGCTCGTGCAACGGCTGCGACATCGAAATCATAGCCATTTTGACACCGAGGTA CGACGCGGAGCGCTTTGGAGTCAAACTCGTCGGAAGTCCGAGGCACGCTGACATACTCCTCGTCACCGGGCCCGTAACCA ACCAGAGCCTTGAGAGGGTCAAACTGGTTTACGAGCAGACACCTGACCCGAAGATAGTGGTGGCCGTCGGGGCCTGTGCC ACCGGTGGCGGTGTCTTCTACGAGAGCCCCTTCACCAACGCGCCGCTGAGCAACGTGATTCCTGTCGATGTTTACGTCCC GGGCTGTCCGCCGAGGCCGGAGGCGATACTACATGGGGTTGTTTTGGCACTGGAAAAGCTGGCTAAAATCCTGAA