tg0046

Coordinates:42476-42736

>tg0046 membrane bound hydrogenase, MbhB subunit (MbhB)
MIEPVFFYSALIISFAAFLAILRILLGPSVPDRVVGVDTLNTLVVAAMVLLGAAYDRTIYIDIAIVYALLSYIGTLIIAR
YLQGGLE

>tg0046 membrane bound hydrogenase, MbhB subunit (MbhB)
atgattgagccggtctttttttactcggcactgataatctcgtttgcggcgttcctggcgatactcaggattctcctcgg
accaagcgtccccgacagggtcgtgggagttgatacgctcaacacgctcgtcgtcgcggcgatggttctcctcggagcgg
cctacgacaggacgatttacattgacattgcaatcgtctacgcgctcctgagctacatcggaacgctcataatcgcgagg
tacctccaggggggattggaa


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 41976 - 43236 (Additional range around tg0046 is :500nt.)

>Thermococcus gammatolerans EJ3 TGCCCTTCATAGTCGCCTTCGTCTTCGCCTACGTCCTCTGGCTCGTTCTAACGGCCGGAACCAACGGGCTACTCTGGAGC AGCCAAGAGCTCATAGCGGGCCTGATATTTGCTGGAATAATCGGGTACGCGACGAAGGACGTCGTCGGGGAGAAGTCGAC CCGCTTCCTGAATCCGATAAGGTGGCTCGAGTGGATTGCCTACGCTCCGGTCCTCTTCTGGGGAATGGTCAAGGCAAACT TCCACGTTGCGTGGCTCGTCATAACAGGGAGGATAAGGCCCGGAATCGTCAGGGTTCCCGTTGACCTCGAGGAGGACGCA CAGTACACGATACTCGGCAACTCGATAACCCTCACGCCCGGAACGCTGACCATAGACGCCCGCCCAGAGGAAAAGGCCCT CTACGTCCACTGGATTGACATACCGAAGGGAATGGAGAGGCCTGAGAGCTCGGAGCCCGTCTCGGGACCCTTCGAAAAGT GGGCCAGGAGGTTGGGGAA atgattgagccggtctttttttactcggcactgataatctcgtttgcggcgttcctggcg atactcaggattctcctcggaccaagcgtccccgacagggtcgtgggagttgatacgctcaacacgctcgtcgtcgcggc gatggttctcctcggagcggcctacgacaggacgatttacattgacattgcaatcgtctacgcgctcctgagctacatcg gaacgctcataatcgcgaggtacctccaggggggattggaa TGAGCTGGGTCAACTACCTGATTTACGCCTTCCTCGCG GTAAACATCACCTTCAACCTCCTCGGGAGCATAGCCCTCCACCGCTTCCCGGACGTTTACACGAGACTTCACGGTGCGAC CAAGTGCACCACCTTTGGAACGATATTCGCCGTTTTTGCGGTTGCGACCCACGCTTTGTACAGACTCCACGTCACGGGCG ATGCGAAGTACCTCCAGATGACCCTCCACAGCTTCGTGGCCCTGATAGCGCTCCTCCTCACGAACCCGGTCGGAGCGCAC GCAATAGCGAAAGCCGCGCACCTGAGCGGTTACAAGCCGGCTAAAGCCGTCATCGATGCATACGAGGAGAAGCTCGGGGG TGGGAAGGAATGAACGCCCTGACACTTGACATGATTATTCAGGCAATAATACTCATCGGCGTCCTCATCACTGCCTACCT CACGATTCGCTTCAGGGACCTTCTCGCGGCAACGCTTATGTCGGCCGCGATGAGCCTGCTCC