tg0047

Coordinates:42736-43236

>tg0047 membrane bound hydrogenase, MbhA subunit (MbhA)
MPFIVAFVFAYVLWLVLTAGTNGLLWSSQELIAGLIFAGIIGYATKDVVGEKSTRFLNPIRWLEWIAYAPVLFWGMVKAN
FHVAWLVITGRIRPGIVRVPVDLEEDAQYTILGNSITLTPGTLTIDARPEEKALYVHWIDIPKGMERPESSEPVSGPFEK
WARRLGK

>tg0047 membrane bound hydrogenase, MbhA subunit (MbhA)
ttgcccttcatagtcgccttcgtcttcgcctacgtcctctggctcgttctaacggccggaaccaacgggctactctggag
cagccaagagctcatagcgggcctgatatttgctggaataatcgggtacgcgacgaaggacgtcgtcggggagaagtcga
cccgcttcctgaatccgataaggtggctcgagtggattgcctacgctccggtcctcttctggggaatggtcaaggcaaac
ttccacgttgcgtggctcgtcataacagggaggataaggcccggaatcgtcagggttcccgttgacctcgaggaggacgc
acagtacacgatactcggcaactcgataaccctcacgcccggaacgctgaccatagacgcccgcccagaggaaaaggccc
tctacgtccactggattgacataccgaagggaatggagaggcctgagagctcggagcccgtctcgggacccttcgaaaag
tgggccaggaggttggggaaa


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 42236 - 43736 (Additional range around tg0047 is :500nt.)

>Thermococcus gammatolerans EJ3 TGGTTGGTGTGCCGCCGTTCAACGTGTTTTTCAGTAAGTTACTTCTCTTCAACGCGTTCTTGGATGAGAATCCAGTGCTG GCTTTGGTGCTTGTTGTTAGTTCGGTGACTGCCTTGGTGGCTTATGTGAGGGTGTTCTATGAGGTTTGGCTTGGAAAGCC CGGGAAGGAGGTTGAGCTCAGAGAAAGCTGGAGCATGAGTGGTGTTTGCTTGGTTTTGGCTTTGGCGTGTGTTGTTGTTG GCTTGGTTGCTCCGTATGTGGTCAGTCACTACGTTGAGCCGGCAGCTGTTCAGGCGGTGGATTACAGGGTGTACATCCAG AAGGCCTTGGAGTACGCGGCAAAAACCAAACTCGGCCTCTGAGCCCTTCTTTAACTTTTGGTTTACAACGAGGCGTTTCT TACCTTTTTTTGACAAACTGAGCTTTGGAAAACCGTTTTAAGCGGGAAAGAGAAGTCAAAATCGAGGGTAAACAAAAATG TTAATCCGGAGGTGGTAGC ttgcccttcatagtcgccttcgtcttcgcctacgtcctctggctcgttctaacggccgga accaacgggctactctggagcagccaagagctcatagcgggcctgatatttgctggaataatcgggtacgcgacgaagga cgtcgtcggggagaagtcgacccgcttcctgaatccgataaggtggctcgagtggattgcctacgctccggtcctcttct ggggaatggtcaaggcaaacttccacgttgcgtggctcgtcataacagggaggataaggcccggaatcgtcagggttccc gttgacctcgaggaggacgcacagtacacgatactcggcaactcgataaccctcacgcccggaacgctgaccatagacgc ccgcccagaggaaaaggccctctacgtccactggattgacataccgaagggaatggagaggcctgagagctcggagcccg tctcgggacccttcgaaaagtgggccaggaggttggggaaa TGATTGAGCCGGTCTTTTTTTACTCGGCACTGATAATC TCGTTTGCGGCGTTCCTGGCGATACTCAGGATTCTCCTCGGACCAAGCGTCCCCGACAGGGTCGTGGGAGTTGATACGCT CAACACGCTCGTCGTCGCGGCGATGGTTCTCCTCGGAGCGGCCTACGACAGGACGATTTACATTGACATTGCAATCGTCT ACGCGCTCCTGAGCTACATCGGAACGCTCATAATCGCGAGGTACCTCCAGGGGGGATTGGAATGAGCTGGGTCAACTACC TGATTTACGCCTTCCTCGCGGTAAACATCACCTTCAACCTCCTCGGGAGCATAGCCCTCCACCGCTTCCCGGACGTTTAC ACGAGACTTCACGGTGCGACCAAGTGCACCACCTTTGGAACGATATTCGCCGTTTTTGCGGTTGCGACCCACGCTTTGTA CAGACTCCACGTCACGGGCGATGCGAAGTACCTCCAGATGACCCTCCACAGCTTCGTGGCCC