tg0049

Coordinates:44956-45438

>tg0049 Membrane bound complex 1, subunit B (Mbc1B)
MRGVAATALLAFITYIIFTGSLTPYDLVTGVIVGVTIGLLVGRFLVENDAKALNPVRWAWGLVYFLWYFLVAEVKAHLDV
MRRIITGDIEPGIVKVPLKVKSEYARTLVANSITNTPGTVVVDVDENYLYVNWINVTTEEPEEAKKEICEEFEKYAERIF
E

>tg0049 Membrane bound complex 1, subunit B (Mbc1B)
atgaggggagttgcggcgacagccttgctagccttcatcacgtacatcatcttcacgggctcactcacaccttacgattt
ggttactggcgtaatagttggagtaaccatcggcctcctcgttgggaggttcctcgtggagaatgacgcgaaagccctca
atccagtcaggtgggcgtggggattggtttacttcctctggtacttccttgtcgcggaagtcaaggcgcacttggacgtg
atgaggcggataatcactggtgacattgagccgggcattgtaaaggttccgttgaaggtgaagagcgagtacgcgaggac
tctcgttgccaactcgattaccaacactcctggaacggtcgtggttgacgtggatgagaattacttgtacgtgaactgga
ttaacgtgactactgaggagcctgaagaggctaaaaaagaaatctgtgaggagtttgagaagtacgcggagaggatattc
gag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 44456 - 45938 (Additional range around tg0049 is :500nt.)

>Thermococcus gammatolerans EJ3 CTCTTCGAGTACCTCGCGGTAGGCGCGGGCTTCACGGCGGTCTTCCTGCTTCTCAGCATTCCAGAGGAGAAGTTCAAGAA ATTCCTGGGGGTGAGGAGATGATATCACTCCTATGGAGCATTACGATAGTCTCACTCCTCGCGACGCTCATCATAAGCGT TTACGGAATCGTTGCAAAACCAAACCTCGTGAAAAAACTCATAGCCCTGACAATCTTCGGCGATACGGCAAACGTCCTCG TCGTCCTCCTCGGTTACAGAGTAATTTACCCAGTAAAACCCCCAATCCTGCCCGAACTCTCAAAGAGTGCCGTTGGAGAG TTCGTTAAAACGGCCGTTGATCCACTGCCACAGGCACTGGTCATAACTGCGGTAGTCATTGGCATGGCGGTCAACATTCT CATCGCCTTCGCGGTAATTCAAATTTACAGGATTTACGGGACGCTGGACGTTAGAGAAGTCGGGAAGAGCCTACCAGAAC TGCTGAGGAGGGATGAAGC atgaggggagttgcggcgacagccttgctagccttcatcacgtacatcatcttcacgggc tcactcacaccttacgatttggttactggcgtaatagttggagtaaccatcggcctcctcgttgggaggttcctcgtgga gaatgacgcgaaagccctcaatccagtcaggtgggcgtggggattggtttacttcctctggtacttccttgtcgcggaag tcaaggcgcacttggacgtgatgaggcggataatcactggtgacattgagccgggcattgtaaaggttccgttgaaggtg aagagcgagtacgcgaggactctcgttgccaactcgattaccaacactcctggaacggtcgtggttgacgtggatgagaa ttacttgtacgtgaactggattaacgtgactactgaggagcctgaagaggctaaaaaagaaatctgtgaggagtttgaga agtacgcggagaggatattcgag TGAGGTGGTGAGGATGAACGTGGTTGGCCTGACCCCAATAATCCCAATCCTCTTCG CCTTCGCATTACCGCTAACTTCAATCCTCGTCAAGGGCGACAGGAGGATTGTGCAGGCTTACGCTTTGACAGGCACGGGC TTGACCCTCCTGAGTGCCGTCAAACTCTTTCAGCTGGCGTACTCTTCAAACGAGCCTTTGATTTACACTTTCGGTGGTTG GACTGCTCCGGTGGGCATAATTTATGAGGTTGACAGGATGAGTGCTTTAATAGCCCTGGTAACTGCCGCGTTAATGTTCC TCATTGCAATCTACAGTTACCGCTACCTTGAGGGCGAGGGTGGTTTGGAATGGTATTACACGCTTTACCTCGGGCTTGAG GCTGGCTTGCTCGGCGTCCTCTTAACGGGCGACGCGTTTAACCTCTTCGTCATGATTGAAGTTACCAGCATCGCGGCTTA CGCTTTAGTCATGTACTACAGGGATAGAGGGGATTCTGTCGTCG