tg0058

Coordinates:49608-50102

>tg0058 formate hydrogenlyase II subunit G (Mhy2G)
MAVTLKYPFVKIEAPPEYRGVPHINPRLCIGCGACVNACPADALLRIDDYEKGTRKIVLDVGRCIRCARCDEACPTGAIR
MTRNFEVATLDRKDHVEVVELRLHRCPNCGSYTDYTERALEKALQILPEGLFDGDEIRKRAILCRNCRRKLTVDDAVEAS
REVVE

>tg0058 formate hydrogenlyase II subunit G (Mhy2G)
atggccgtcacgctgaagtaccccttcgtgaagattgaggcccctcccgagtacaggggagttccgcacataaacccgag
gctctgcataggctgtggcgcctgcgttaacgcctgtcccgccgatgcgctgctgaggatagacgattacgaaaagggaa
cgagaaaaatcgtcctcgacgttggcaggtgcatacgctgtgcccgctgtgacgaggcctgcccgacgggagcgataagg
atgacgaggaacttcgaggtggcaaccctcgacaggaaagaccacgtcgaggtcgttgagctaaggctccacaggtgtcc
caactgcggaagctacacggactacaccgagagggccctcgaaaaggccctccagatactcccagaggggctcttcgacg
gggatgaaatcagaaaacgcgcaatcctctgcaggaactgcaggaggaagctcacagttgatgatgccgtagaggcgagc
agggaggtggtagaa


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 49108 - 50602 (Additional range around tg0058 is :500nt.)

>Thermococcus gammatolerans EJ3 GCGAGAAGGGACCACCCGTTTGCGGCCTACAAGTACCTCGACTTCAAGGTTCCGGTTTACAAGGAGGGGGACGTTCTGGC GAGATGTTTAGTAAGGGCGGAGGAGATTCTTGAGTCCATCTGGATAATTGAGCAGGCCCTCGACGAGATGCCGGGAGGGG ACATCCTCGCGGAGTGGAAGGAGATACCTCCGTACCAAGAAGCGGTAGGCTTCACCGAGGCGCCGAGGGGAGAGGACGTC CACTACGTCATGACCGGCGAGGGTAACAGGCTCTACCGCTGGAGGATAAGGGCGTCAACCTACAACAACTTCCCCGCTTT GCCGGACGCTATGAGGGGTAACAGCGTGGCCGATGCCGTTCTGATAATAGCCTCCATGGACCCGTGCTACTCCTGTACCG AGAGGGTTCAGGTCGTTGACGCGAGGAGCGGTAAGGTGAGGGTTCTCACGGAGAAGGAGCTCACAGAACTGTCGAGAAAG GCCAGCAGGGGGGTCTGAA atggccgtcacgctgaagtaccccttcgtgaagattgaggcccctcccgagtacagggga gttccgcacataaacccgaggctctgcataggctgtggcgcctgcgttaacgcctgtcccgccgatgcgctgctgaggat agacgattacgaaaagggaacgagaaaaatcgtcctcgacgttggcaggtgcatacgctgtgcccgctgtgacgaggcct gcccgacgggagcgataaggatgacgaggaacttcgaggtggcaaccctcgacaggaaagaccacgtcgaggtcgttgag ctaaggctccacaggtgtcccaactgcggaagctacacggactacaccgagagggccctcgaaaaggccctccagatact cccagaggggctcttcgacggggatgaaatcagaaaacgcgcaatcctctgcaggaactgcaggaggaagctcacagttg atgatgccgtagaggcgagcagggaggtggtagaa TGAGGCTCCGCTCGCTTTATGTCTTCCACCTCGACACCGGAGCC TGCAACGGGTGCGAGATAGAGCTCTTCGACATTCTAACACCTTACTACGACGCCGAAAGGTTGGGCGTCAGGCTTGCCGC TTCACCGAGGCACGCCCACGCGATGGCCGCAACGGGCCCGCTCACGAGGCAGGCCTACTACGCGGCCAAAGAGGCAATAA AGGCGATGCCCCCGAAGCCGAGGATAATAGTGGCCATAGGAACGTGCGCATGCAGCGGGGGGATATTCTACAACGGCTAT CCGATATACAGACGTCCTGAGAGCGGCAGGGAGGGACAAGAATACCCGAGGAGGGGCGGAATATTCGAGCTGGTTCAGGA CTTGAGGGACGAGGGAGAATACGTTGGTCCCGTCGTTTACATCCCCGGCTGTCCCCCGAGGCCCGAGGAAATACTCTATG GAGTAGCTTTGGCTCTGGGACTCGTTGAGAAGCAGGTCAAGGGGGAGTACTACACC