tg0071

Coordinates:64849-65274

>tg0071 4Fe-4S ferredoxin, iron-sulfur binding
MDIKALKSSIWGREGISVLEVEKCIGCGLCAEACPFNAITIVNDSTRRITFEPEKCGSCGFECNEACPLGAIRGIPDGMT
LTFEFARCRACGRKLPYTVKEAEYMASKLREAGEDDTLVYLCDDCKRKRIFDVARSYEAYVR

>tg0071 4Fe-4S ferredoxin, iron-sulfur binding
atggacataaaagcactgaaaagttcaatatggggcagagaggggataagcgtgctggaggttgagaagtgcataggatg
cgggctctgtgccgaagcatgccccttcaatgcaataacaatcgtaaacgacagcacgcgcaggataacctttgagcccg
aaaagtgcggtagctgtgggtttgagtgcaacgaagcgtgccccctgggggccataaggggcattccagatgggatgacg
ctcacctttgagttcgcccgctgtcgggcctgcggcaggaaacttccgtacaccgtcaaagaggccgaatacatggcctc
aaagctcagggaagccggtgaggatgatacgctcgtctacctttgcgatgattgcaagaggaagcggatatttgacgtgg
cccgaagttatgaagcctacgtgagg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 64349 - 65774 (Additional range around tg0071 is :500nt.)

>Thermococcus gammatolerans EJ3 CAGAGGTTCTCCATTCCCCTCCTGCAGAAGTAGCACTCACCGCAGTGGATTACCGGGAAGATAGCAACTCTGTCCCCGAC TTCAAAGCCCTTAACGCCCTCGCCAATTTCAACGACCTCCCCAGCGAACTCGTGCCCTATCGTTACTGGAGCAGTTCTGC CAGTGAGAGGGTGGGGCCTCTCGGTGGGTATGAAAATCGGTCCGTTGAGGTACTCGTTCAGGTCGGTTCCGCATATTCCA CAGGCTTTCACTTTGATTTTGATGAAGCCCGGCTTAACTTGGGGCTCGGGGATGTCCTCAAGCCTCAGATCCCTCCTTCC GTGCCACCTGACCGCGAGCATTTCATGCACCTCAGGTGCGTGACAAGGGATGCATTGACTTAATTCCTTTTCTCCAACGC TTCGTTGGACACCTTTGGTTCAGTAAAAGCGGTTCAAAAAACGCTTTTTAACCCCGATAATGGAAATTTCAGTGTACAGA AAACGAATCCAACAAAAAT atggacataaaagcactgaaaagttcaatatggggcagagaggggataagcgtgctggag gttgagaagtgcataggatgcgggctctgtgccgaagcatgccccttcaatgcaataacaatcgtaaacgacagcacgcg caggataacctttgagcccgaaaagtgcggtagctgtgggtttgagtgcaacgaagcgtgccccctgggggccataaggg gcattccagatgggatgacgctcacctttgagttcgcccgctgtcgggcctgcggcaggaaacttccgtacaccgtcaaa gaggccgaatacatggcctcaaagctcagggaagccggtgaggatgatacgctcgtctacctttgcgatgattgcaagag gaagcggatatttgacgtggcccgaagttatgaagcctacgtgagg TGATGAAGATGAAAGGTATGAACTTCGCCTTCC TGTGCCGGGAGAAACCCGAGCCTACTGGAAAGAAGGTCGCAATAATCGGTGCCGGACCGGCCGGCCTCGCCGCGGCTGGC TACCTCGTCTGCCAGGGGCACGAGGTTCACGTCTACGACAAGCTCCCAGAGCCAGGGGGGCTGATGCTCTTCGGCATTCC AGAGTTCAGGATTCCGATTTACAGGGTAAGGGACGGCTGTGAGAGGCTGGAAAACGCCTTCGGGGTAAAGTTCTTCCCGA GGACAAAGGTGTGCTTCGGCAATCCAAACGAGAACGGCGACGACTTCGTGGAGAGGAGGATAGACTTCGAGGAGATCGTG AAGAACTACGACGCGGTTCTGATAGCTACGGGAACGTGGAACGCCTACGTGCCAACCATACCGGGTTCCGACCTCGAGGG GGTCTTCCCGGCCCTCGAATACCTGTTCAAGATCAAGAGCGCCAAGCTCGGGCACATGGACTGGGAT