tg0074

Coordinates:67421-67645

>tg0074 Putative nucleotide binding protein, containing TRAM domain
MVLGMYGDRFGGYGNEAPVKVGERYRVKIESLGKGGDGIAKIKGFVIFVPNTQVGDEVEIVINSVKRKFAFAQVI

>tg0074 Putative nucleotide binding protein, containing TRAM domain
ttggtgttaggtatgtatggagatagatttggtggatatggaaacgaggccccggtcaaggttggggagcgctacagggt
taagattgagagccttggtaagggtggcgatggcatcgccaagataaaggggttcgttatcttcgtcccgaacacccagg
tcggagacgaggttgagatcgttataaactccgttaagaggaagtttgccttcgctcaggttatc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 66921 - 68145 (Additional range around tg0074 is :500nt.)

>Thermococcus gammatolerans EJ3 CGTCCTTGGGACGGGCAACAGGAGCGAGTTCCTGACTGGATATTTTACAAAATGGGGCGACGGCGCGAGCGATTATGCTC CCCTCATAAACCTCTACAAGACCGAGGTATGGGAGGTTGCCAAGCTCTTGGGAGTTCCGGAAAGGATCATCGAGAAGAAG CCGAGAGCAGGTCTCTGGGAGGGGCAGACTGATGAAGACGAGCTTGGAATAAGCTACCGCCTCCTCGATGAGATACTCTG GCGCCTTGTAGATTTGAAGATGCCAAAGGAGGAGATAGCGGGGGAACTTGGCATTCCAGTCGAGAGAGTTGAATACGTCG AGAACCTTGTGAGGAGAAGCGAACACAAGCGCCGTTTGCCTCTCGGACCGGAGTTTTAGGCGTTTTCACGCTCTTATCTT AATCATCTTTGATACCAATGCAAACCTTTATATACTCTACAACTAACCTCCCAGTGGGACTCTTCTCGGAGTCTTTCGAG GGAGCCCCAATACTGGAAAG ttggtgttaggtatgtatggagatagatttggtggatatggaaacgaggccccggtcaa ggttggggagcgctacagggttaagattgagagccttggtaagggtggcgatggcatcgccaagataaaggggttcgtta tcttcgtcccgaacacccaggtcggagacgaggttgagatcgttataaactccgttaagaggaagtttgccttcgctcag gttatc TGAAGGTTCAAGCTCACATCTCACGCCCGCAAGGGCTTTTCCACTACTTTTTTGACAAACTTTTTTAGAGGGG CCGAGAAGTTTAACCGGTGGTTACCATGAAGGTCACAGTTAGGTACTTCGCCCGCTACCGCTCCCTAGTCGGTAAGGGAG AGGAGGAAGTCGAGCTCCCCGAAGGAGCGACCGTCATGGATCTTATTGAGAAAATAAAAGAGATGCATCCAGTTCTCAGG AACGAGGTCTTCGCGGAGGACGACGACCTTGCGGACGTCAACGTATCGCGCAACGGGCGCTACGTACGCTTCGACGAGAC ACTTCGGGAGGGTGACGTGGTCGCCATCTTCCCCCCGGTGAGTGGAGGCTAATCATTTCCTCCTTCTTACGATCATAAGG GGCCACAGGGAGAGCAGAGTGATCACTCCGGGGCCGCAGAGGGCTTTAACTGAGTCTGAAACCGAACTTGAAGGCCTTGG AGAGCCGATGTGCTCTGGGGTTCCAT