tg0075

Coordinates:67744-68007

>tg0075 Molybdopterin synthase, small subunit (moaD)
MKVTVRYFARYRSLVGKGEEEVELPEGATVMDLIEKIKEMHPVLRNEVFAEDDDLADVNVSRNGRYVRFDETLREGDVVA
IFPPVSGG

>tg0075 Molybdopterin synthase, small subunit (moaD)
atgaaggtcacagttaggtacttcgcccgctaccgctccctagtcggtaagggagaggaggaagtcgagctccccgaagg
agcgaccgtcatggatcttattgagaaaataaaagagatgcatccagttctcaggaacgaggtcttcgcggaggacgacg
accttgcggacgtcaacgtatcgcgcaacgggcgctacgtacgcttcgacgagacacttcgggagggtgacgtggtcgcc
atcttccccccggtgagtggaggc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 67244 - 68507 (Additional range around tg0075 is :500nt.)

>Thermococcus gammatolerans EJ3 ACCTTGTGAGGAGAAGCGAACACAAGCGCCGTTTGCCTCTCGGACCGGAGTTTTAGGCGTTTTCACGCTCTTATCTTAAT CATCTTTGATACCAATGCAAACCTTTATATACTCTACAACTAACCTCCCAGTGGGACTCTTCTCGGAGTCTTTCGAGGGA GCCCCAATACTGGAAAGTTGGTGTTAGGTATGTATGGAGATAGATTTGGTGGATATGGAAACGAGGCCCCGGTCAAGGTT GGGGAGCGCTACAGGGTTAAGATTGAGAGCCTTGGTAAGGGTGGCGATGGCATCGCCAAGATAAAGGGGTTCGTTATCTT CGTCCCGAACACCCAGGTCGGAGACGAGGTTGAGATCGTTATAAACTCCGTTAAGAGGAAGTTTGCCTTCGCTCAGGTTA TCTGAAGGTTCAAGCTCACATCTCACGCCCGCAAGGGCTTTTCCACTACTTTTTTGACAAACTTTTTTAGAGGGGCCGAG AAGTTTAACCGGTGGTTACC atgaaggtcacagttaggtacttcgcccgctaccgctccctagtcggtaagggagagga ggaagtcgagctccccgaaggagcgaccgtcatggatcttattgagaaaataaaagagatgcatccagttctcaggaacg aggtcttcgcggaggacgacgaccttgcggacgtcaacgtatcgcgcaacgggcgctacgtacgcttcgacgagacactt cgggagggtgacgtggtcgccatcttccccccggtgagtggaggc TAATCATTTCCTCCTTCTTACGATCATAAGGGGC CACAGGGAGAGCAGAGTGATCACTCCGGGGCCGCAGAGGGCTTTAACTGAGTCTGAAACCGAACTTGAAGGCCTTGGAGA GCCGATGTGCTCTGGGGTTCCATGCTGGAGGCCCTCGCTGGTTCCGGGTTCGCCTGTTGACACGACGCTACTGCCGTTCC CAGTATCCCACGCCCCACAGCCGACAAAGCGAACGAGCAATGGATCCTTGCTCTCGTCGTAGGGTATCCACGCATAAGTG CCGTTCTTCGTCTCGTACCACCCGATGTGGGAGTTCCAGCCGGCGTTGCCCCACTCAGAGACCTCCGCTATCTCCTCGAT GTCCTCCTCAGTGAGGCCCCTGACAACGCCCCTGGCGACGAGCTCTTCAAGAACCTTCATCATTACCATCGAGGCGTTTA CCTCCGAGGTATCGTAGGCCGGCCCCTCCTCGGAGCGCGATTGAACTTCGATCTTCGTGCAGTTT