tg0079

Coordinates:71313-71792

>tg0079 Transcription regulator, PadR-like family
MSDSSLVRNLFTVPMKNLILLIIGLKGETHGYEILKEIERITFGNWKPSHGNLYTMLNKLADEGLVESREEYRGKRRVIR
YRLTEKGWLYLREANELTLKSLYLAIQYHERLREKLREMGYGRELAKEAVGEYLKLLDGIIEILQKKREQLRDMIENSPN

>tg0079 Transcription regulator, PadR-like family
atgtcggactcaagcctcgtgagaaacctcttcacggtcccgatgaagaacctcatcctcctgataataggcctgaaggg
ggaaacccacggctacgagatactgaaggagatagagagaataaccttcggcaactggaagcccagccacggcaacctct
acaccatgctcaacaagctggcggatgagggactagtcgagtcgagggaagaatacaggggaaaaaggagagtcatcaga
tatcgcctcacggagaaaggatggctctaccttagagaggcaaacgaactcaccctgaaatccctctatctggcaattca
gtatcacgagaggcttagggagaagctcagggaaatgggatacggtagagagctcgccaaggaggccgttggggaatacc
tcaaactgctggacggcatcatagagatactccagaaaaagagagagcagcttagagatatgatcgagaactctcccaat


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 70813 - 72292 (Additional range around tg0079 is :500nt.)

>Thermococcus gammatolerans EJ3 TCAGCGTGAGGTTGTAGTCCATATCCCAGAGCATGTCGAGGGCGTCGTAGTAGGAGGTTACGTTCGTGGCGTACCTACCT TCTACGCGGTCCTTAAACGCGTAGTAGGCCTTCCTCGCGTTCTCGTCGTTGACGCTGATGTTGGTTATTATCAGGTACGT CATGTTCTCGTTCTGGGCTTTTGTGAACTCCTCGCTCATGATGTCCTGAACTCTGATTGACTCTATCTTATGCGACACCA TCTGCTCGGTGCTGTAATCGGTCAGCTCACCGATCTTTCCTGCTAAAGGTGCTAGAATAAGGATAAGCGCCACCCAAATT GCCAGCACTGTCTTTGGGTGCTTTGCAATCCACTCGTTCCAGGCCATCTTGACACCCCCAAAGATTTTTAAATGATTGTC ATGAATATGTAAATTGTAAACCTATCTAATTCAGATAGGTCTAATTCAGACATATATGGGCAGGGTGAAGCTTATAAGCC TTTCGCCGGTGGTGAGACC atgtcggactcaagcctcgtgagaaacctcttcacggtcccgatgaagaacctcatcctc ctgataataggcctgaagggggaaacccacggctacgagatactgaaggagatagagagaataaccttcggcaactggaa gcccagccacggcaacctctacaccatgctcaacaagctggcggatgagggactagtcgagtcgagggaagaatacaggg gaaaaaggagagtcatcagatatcgcctcacggagaaaggatggctctaccttagagaggcaaacgaactcaccctgaaa tccctctatctggcaattcagtatcacgagaggcttagggagaagctcagggaaatgggatacggtagagagctcgccaa ggaggccgttggggaatacctcaaactgctggacggcatcatagagatactccagaaaaagagagagcagcttagagata tgatcgagaactctcccaat TAGTTCTTTTCAAGAAAACGCTATCTATTTCTCCGTCTTCAAGTTCTCAGAGGTTAGGA GAAACTTTAAGTAAAAAACCTTGCTCAGAAGAGCTAGAAACGTAAACGAGCTAAGTGCAGGGGCCGCTAAAATCTTCAGA AACCCTGTCAGTTCCCAGATTTTTGCAAGTGCCGGCAGAAAGGGCACAATCGCAGCCATGAAGAGAACAATCGAGTTGAG ACGGGAAAACCAGAGGCTAGTCCTCAAACCTTCGATCTTCCAGAGGACGCTGTTCCTTATTCCAACCGATAGGTAATTAA CAACCGCACCTACAAGCGCAACGATCGAAGTCGCGAAGAACTCACTGGGGCCAAAGGGAAACACATTTCTTATAACTGCA GAGTACGTGTAAAACGCGGAAATACCAATCAGGAACCACGATAGTGCCCTTAGAAAGTAAGCTATCGTGAATCTCCTGAC CGCCCATGTTCCAAACCTTTTTCTCACGAGCTCTCTCATGC