tg0088

Coordinates:83671-83808

>tg0088 hypothetical protein TGAM_0088
MIVKFEVYFDGEYWCAKGIDDDIFTQGKTLDELMENIREAVEVHFS

>tg0088 hypothetical protein TGAM_0088
atgatagtcaagttcgaggtatatttcgacggtgagtactggtgtgccaaaggcatagatgatgatatcttcacccaggg
gaagaccctcgatgagcttatggagaacataagggaagccgttgaagtgcacttttct


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 83171 - 84308 (Additional range around tg0088 is :500nt.)

>Thermococcus gammatolerans EJ3 TGAGGGAACTTGGGCTTGAGGAGCTCTACGCGGGAAAAGGGATAGCACTCTTCAGGAGCGGGGACGTTGTGGCGCTTCTG TTCCCGAGGGAGAGCTTAGTCGTTGACGTGATCCCGGCGAGCGGAGAGGTAAGCGACGCGCTTGAGATCATAGCTTACCA CGACAGAAAGCTCAACTCTCTTATCCTTGAGATACTGCCTGCGAACGATCTGGAGTACGAGGGCAACATAGGGCTCGAGC CCGTGATAGTGAACCTCGAAACCGGTGAGCTCGAGAGCAATCCCGTTCTGGGCGACTTCGAGGAGGAAAAGGACGGCATC TACCTCGTCGTTGATAGGGAAACCCTCGAGCGCTGGAAGGAAAACGGAAACATCGAAACGTGTCCCCTCTGCGGCGGCGA ACTCGCGTGGCGCGGGAAGAAGGCGGTCTGTCTGGACTGCGGTTACGGGGTTAAGGTTAAAGATTAAGTACCATGCCAAC GAAGAATACACGGTGAGAGC atgatagtcaagttcgaggtatatttcgacggtgagtactggtgtgccaaaggcataga tgatgatatcttcacccaggggaagaccctcgatgagcttatggagaacataagggaagccgttgaagtgcacttttct TGAGAGGTGATTTCCATGAGCCGAATAGCAAAACGCCAGCTCGTTCTCTACTCGAGGAAGGCCCACGAGCGCGGTTTAAC TGCAGCTTTCGGCGGGAACCTGAGCGTCCGCGTCGGAAATTTGGTATTCATCAAGGCGACCGGAGCGGTTATGGACGAGA TGACCGATGAGCAGGTGGCCGTGATAGACCTCAGCGGAAATCAGCTCTCGGACGTTAGGCCCTCCTCCGAGTACAGGCTT CATCTGGCCGTTTACAGGGTAAGGCCTGACGTTAAGGCAATAGCTCACCTCCACCCTCCGTACTCGATAGTCGCCTCGAC CCTGCTCAAGGGAGAACTGCCGATAATAACGCCCGAGGCCGAGATATACCTGAAGAGGATTCCAATTGCACCCTTCCGCC CGGCGGGCACAGAGGAGCTCGCGGAGGTCACGGCAGAAGCCTTGAAGGAGGCGGACGCGGTCTTGATGGCGAAGCACGGA ATCGTGACCGTCGGAAAAA