tg0092

Coordinates:85641-86327

>tg0092 Amino acid ABC transporter, permease protein
MITSTSVPLDIALRMLLNGAKTTIVLSVFSILLGLLIGLPVALMETYGGKTLRRVAMVYEGTLRGIPLLAIYFVIFYSMP
MLIGLGLSPFLAAVVGLGIRSSAYQSQIFRSGIQAVDEGQIEAALSLGMSQWQIIRHIVLPQALRMSIPAWMNEYVIVLK
DTSIALALGIVELTRQATYLVSITAEPFRYYGLAALFYLAMVLPLTYLANWMGKRYGIKGTGGAMDVRL

>tg0092 Amino acid ABC transporter, permease protein
ttgattacctccacgagcgttccgttagacattgccctcagaatgctcctgaacggtgctaaaacgacgatagtcctgtc
ggtgttctcgatccttctcggccttctcataggtctccccgtcgcactgatggaaacctacgggggtaaaaccctgaggc
gggtcgcgatggtttacgaggggacgctgagggggatcccactcctcgcgatatacttcgtgatcttctactcgatgccg
atgctcatcggtttggggctctcaccgttcttagccgccgtcgtcggccttgggatacgctcatcggcctatcaatccca
gatattcaggagcggcatacaggcggttgatgaagggcagatagaggcggcgctctcgctcggaatgagccagtggcaga
taataaggcacatcgttcttccgcaggcgctgagaatgtctattccagcctggatgaacgagtacgtcatagtcctgaag
gacacgtcaatagcactggccctcggcatagtggagctcacgaggcaggcaacttacctcgtttcgatcacggcggagcc
cttcaggtactacggactggcggcgctgttctacctcgcgatggttctgcccctgacttacctcgcgaactggatgggta
agaggtacggaataaagggaaccggaggggcgatggatgtcagactc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 85141 - 86827 (Additional range around tg0092 is :500nt.)

>Thermococcus gammatolerans EJ3 CCGGAATGACCATAACCGAGAAGCGCAAGCAGGTCGTTGATTTCAGCATTCCCTACTGGAAGGCGGATCAGGCCGTCGTC GTCAGGAAGGACTCAAGCATCACGGTCAGCTCCCTTGACGACCTGAAGGGTAAGGTGATAGGCGTCGAAAAGGGAACAAC CGGCGCGATTTACATTAAGGACAACCTCGGGGATCAGGTCACGCTCAAGGAGTACAACAGCTACGTCGCGGCGCTTCAGG CCCTCCTGAACGGTCAGGTTGACGTCCTCGTCATAGACTCGCCCGTTGCCAACATGTTCACCAACAAGTACGACGTCAAG GTTGTCTACACAATAAACACGAACGAGCACTACGGAATAGCTGTTAAGAAGGGCAACAAGGAGCTCCTCGACAAGATAAA CAAGGCCCTCCAGGATATCATGAACTCGCCCGATTGGAACAAGCTCGTTGAGAAGTACTTTGGAAGCTGACCTCTTCTCT ATTTTTTGGAGGTGCCACGC ttgattacctccacgagcgttccgttagacattgccctcagaatgctcctgaacggtgc taaaacgacgatagtcctgtcggtgttctcgatccttctcggccttctcataggtctccccgtcgcactgatggaaacct acgggggtaaaaccctgaggcgggtcgcgatggtttacgaggggacgctgagggggatcccactcctcgcgatatacttc gtgatcttctactcgatgccgatgctcatcggtttggggctctcaccgttcttagccgccgtcgtcggccttgggatacg ctcatcggcctatcaatcccagatattcaggagcggcatacaggcggttgatgaagggcagatagaggcggcgctctcgc tcggaatgagccagtggcagataataaggcacatcgttcttccgcaggcgctgagaatgtctattccagcctggatgaac gagtacgtcatagtcctgaaggacacgtcaatagcactggccctcggcatagtggagctcacgaggcaggcaacttacct cgtttcgatcacggcggagcccttcaggtactacggactggcggcgctgttctacctcgcgatggttctgcccctgactt acctcgcgaactggatgggtaagaggtacggaataaagggaaccggaggggcgatggatgtcagactc TGATAGGGTTC TGATCATAAGGAACCTCACGAAAAGGTTCGGCGAAAAACCCGTTCTGAAGGGGATCTCCTTCGAAGTTGAGAGGGGAGAG ACAAAGGTCATCATCGGGCCCAGCGGGGCCGGAAAGAGCACCCTCCTCAGGTGCATAAACAGACTCATTGAGCCAGATGG GGGGGAGATAATATTCAACGGAACCAACATCCTGGAAAGGGGTGTGGACATAAGGAAGATTCGAGCCAAGATAGGCTTCG TCTTCCAGCACTTCAACCTGTTCAAGCACCTCACCGCCCTTGAAAACGTTAAAATCGGCCTCAAGGTCGTCAGGGGGATG AGCGACGAAGAAGCCGAGAAGAAGGCAATCAAAGCCCTCAGGATGGTCCACCTGGAGGAGGACGCGTTCCACAAGTACCC GGCCCAGCTCTCGGGCGGCCAGCAGCAGCGCGTTGCAATAGCGAGGGCACTGGCAATGGAGCCTGAGATAATCCTCTTCG ACGAGCCG