tg0094

Coordinates:87078-87182

>tg0094 ABC-type amino acid transport system, permease component, N terminus fragment
MMVWETIARYLLHGLVVTLELTIVGFIGGFASGSS

>tg0094 ABC-type amino acid transport system, permease component, N terminus fragment
gtgatggtctgggaaacgatagcgcggtacctccttcacggactcgtcgttaccctggagctcacgatcgtgggcttcat
aggcggcttcgcttcgggttcctct


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 86578 - 87682 (Additional range around tg0094 is :500nt.)

>Thermococcus gammatolerans EJ3 GTCTTCCAGCACTTCAACCTGTTCAAGCACCTCACCGCCCTTGAAAACGTTAAAATCGGCCTCAAGGTCGTCAGGGGGAT GAGCGACGAAGAAGCCGAGAAGAAGGCAATCAAAGCCCTCAGGATGGTCCACCTGGAGGAGGACGCGTTCCACAAGTACC CGGCCCAGCTCTCGGGCGGCCAGCAGCAGCGCGTTGCAATAGCGAGGGCACTGGCAATGGAGCCTGAGATAATCCTCTTC GACGAGCCGACCTCGGCCTTAGACCCTCAGCTGGCCGGAGAGGTGCTCGACGTCATGCGCGAGCTCGCGAAGAAGAAGGT CACCATGCTCGTCGTGACCCATGAGATAGGCTTCGCCCTCAACGCCGCCGACGAGGTGCTCTTCTTTTACGACGGTGTAA TCTGGGAGAAGGGAAAGCCGGAGGAGATCCTCTACAACCCGAAGAGGAAGGAAACCAGGGAGTTCCTGAAGAGGATAGCT GATCTCTCGGTGGGGGGACC gtgatggtctgggaaacgatagcgcggtacctccttcacggactcgtcgttaccctgga gctcacgatcgtgggcttcataggcggcttcgcttcgggttcctct TAGCTGTGGCCAGAACCTACGGGGGGAGGCTTT CAAGGGCACTCTCGGCAACCTACATCGAGCTCATCAGGGGAACGCCAATGCTCCTCCAGCTCTACATAATCGGCTTCGGG CTCCCGCTTGTGATAAGGGACCACTTCCCGAACTTCGTCATGGATCCAACGGTGGCGGCGGCCCTAGGGATGGTCATCAA CAGCGCGGCCTACCAGGCGGAGTACATAAGGGGTGCCTTCAACTCCATCGAGTACGGCCAGGTTGAGGCGGCCCTCTCAC TGGGGATGACGAAATGGGAGATAATAAGGCACGTGATCTTCCCGCAGGCCTTCAGAATAATGCTCCCGAGCTGGACCAAC GAGATGGTCTACCTGCTCAAGTACTCATCGCTGGCGATGCTCTTAGCTGTCCCGGAGCTGATGTACGAGGCGAGCGTGGC AGCGTCCCAGACATTCCTCTACGCCCAGATATACCTCGTCGTCGCTGGGATCTACCTCGTTTTCGC