tg0098

Coordinates:90529-91155

>tg0098 hypothetical protein TGAM_0098
MKAKREALVSLFTAMREGKVDEDIIDLLLLINSIRGIYTTSSCSGRIGIIEEPALGAKPLSRWLIKVHREMEFEEAKRAL
EKAREGLIFLKSQPPIFHVVAEDLERAKKLHELGLASGFKYTTFKVISNRYLVEINATEYLTAPLGRDGEILVSDDYLHF
AIEIGNSMLRRSKGRLPRLMKNFEKLREELGEDELFYELAEEFGIESAV

>tg0098 hypothetical protein TGAM_0098
atgaaggcaaagcgggaagcgctggtcagcctcttcacggcaatgagagagggcaaagtcgacgaggacataatagacct
cctcctgctcatcaactcaatcaggggaatctacacgacgagctcatgctcgggcaggataggaatcatcgaggagcctg
ccctgggggccaaaccccttagcaggtggctgatcaaggttcaccgcgagatggagtttgaagaggcaaagagggctcta
gaaaaggcgagagaaggcttaatctttctcaaaagccaacccccgatttttcacgttgtggctgaagaccttgagagggc
caaaaagctccacgagctcggtttagccagcggtttcaagtatacgacattcaaggtaatctccaaccgctacctcgtcg
agataaacgccactgagtatctaaccgctccacttggtagggatggagaaatcctcgtcagcgacgactacctgcacttc
gccattgaaatcggcaactcgatgttgagacgctcgaagggcaggcttccgaggctgatgaagaactttgaaaaactccg
ggaggagctcggggaggatgagctcttctacgagctggcggaggagtttggaatagagtctgcagtt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 90029 - 91655 (Additional range around tg0098 is :500nt.)

>Thermococcus gammatolerans EJ3 ACTTCGCGCTCAGCCTTTAAGAAAGGCTGGCGAAAAGATTGCCCTTCTCATCAAACTGGCAGAAAAATCAGTCGTGCACT AGTCAAGTGCAACTTTGACTGGGGTTTAACACTAAATGAAGCCTTCCACGTAGTTTCAACTTTATTGTTGGCGTCCTTCG GACGCCGTTTGTAGAGTGAAACACTCACAGAAGAGCAAATTTGAGCTTAAACCCCTCTAAAATCAAACCTTTAGAAAAAG CACCTAATCTTCCGCCAGCGCTTGCTTTACAAGGGCTGTTATGGGGCCGGGGCCGGGATTTGAACCCGGGCTAGGGGATC CACAGTCCCCTGTGCTGACCAGGCTACACCACCCCGGCCACGTCCAGCTTAAGCTTTCGAGTTAGATTTATAAAGTTTTC GTCAGATGCCGCAAGAGAAAGTAGCTGATCCGGTATTAACCCAATATTGAAAACCAGACGCGGTTAGAGGCCGATTAAAA ACTTTAGAGGGGGCCAACGG atgaaggcaaagcgggaagcgctggtcagcctcttcacggcaatgagagagggcaaagt cgacgaggacataatagacctcctcctgctcatcaactcaatcaggggaatctacacgacgagctcatgctcgggcagga taggaatcatcgaggagcctgccctgggggccaaaccccttagcaggtggctgatcaaggttcaccgcgagatggagttt gaagaggcaaagagggctctagaaaaggcgagagaaggcttaatctttctcaaaagccaacccccgatttttcacgttgt ggctgaagaccttgagagggccaaaaagctccacgagctcggtttagccagcggtttcaagtatacgacattcaaggtaa tctccaaccgctacctcgtcgagataaacgccactgagtatctaaccgctccacttggtagggatggagaaatcctcgtc agcgacgactacctgcacttcgccattgaaatcggcaactcgatgttgagacgctcgaagggcaggcttccgaggctgat gaagaactttgaaaaactccgggaggagctcggggaggatgagctcttctacgagctggcggaggagtttggaatagagt ctgcagtt TAAAACTTTTAGAGTTTTGGCGCTTCTCTTGAGGCTGAGTCTCTCTTTTGGAACACTATCTCAAGCGCCTC GCGGTCGAGGTAAACACCCAGGGCCATCACCTCTTTCGGGGTTTGTACAATTTCACCCCAAAGTCCCTCATCCTCTCAAA ATGGTCAATGTTCGTGGTCCACACGGTATAGCCTTTAGCTATCGCGGTGGCGCCGATGAGTATATCAGCGTCATCGATTA GCTCTCCTTTCCTCTTCAAGTGCCTGTATATTTTCGAGGCCGTGAGGATTATTACGTTGTCAAGGGGCTCAACCTTGAAC AGCTTCTCCAGCCTCTTAAGAACTTCCACTCTCTTTCTCTCACTGCGGATTCACCTCACGAACTCAAAGAGAGTGATGAT TGAGATTGCCGAGCCTGAGTATTCTTCGAGCTTTCTGTCATGATACAAGTCAATTAAAACGCTCGTATCAATCAATATCC CCGAAGTCCCTGAACGAGACCCTCTTCT