tg0101

Coordinates:91808-92026

>tg0101 hypothetical protein TGAM_0101
MAGVRVLYLGENKKRGSFMGATRSEIVVEVPKGMSVSEIRKMVREIVLRYLREKGASEEELKKVRVRVEVLEE

>tg0101 hypothetical protein TGAM_0101
ttggctggcgttagggttttatacttaggcgagaacaagaagcgagggagctttatgggagcgaccaggagcgagattgt
ggttgaggttcccaaaggaatgagcgttagcgagattcggaagatggtgagggagattgtcctcagataccttcgagaga
agggcgcgagcgaggaggagctgaaaaaggtgagggttagggtggaggtgcttgaggag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 91308 - 92526 (Additional range around tg0101 is :500nt.)

>Thermococcus gammatolerans EJ3 GACGAGGAGGAAGGGTGTAATCCTTCAGCATGGCACCTTCATGTACGCGACGCGCGTTGACGTGCTTGGTAGAGTTCTCC GCGTTTCGAAGGCGAAGCTCGCAGATAAGGGCGTTTCGAGCATCTGGGAGCGCGTTACAACGCTGGAGCGCGAGGGGATA AAGCTGAACCGCTGGGAGGCCTACGAGCTGTTGAAAGAGAGCTTTTTCAGAGCCTTCGAACTCGAGGAGGGGGAGCTTAC AGACTATGAGCTTGAACTCGCGGAGGAGCTGATAGAGAAGCGCTATGGAAACCCCGAGTGGAACGAGATGAAGTGAAACC TTATGGGCTCCCCTTCCCTTTTTCTTGCTCTCATCGAGGATTAGAATCCTTGGATTCCTTGCCAGAGCGCTCGCGAGGCC AATCCTCTGCCTCTGCCCCAGTGAGAGGTTCTTGGAGAGTAGCGTTGAGATGAAGAGCTTCTGCTTGAGCCACGCGGCCG CTTTGGTCTCGGCCCTCCT ttggctggcgttagggttttatacttaggcgagaacaagaagcgagggagctttatggga gcgaccaggagcgagattgtggttgaggttcccaaaggaatgagcgttagcgagattcggaagatggtgagggagattgt cctcagataccttcgagagaagggcgcgagcgaggaggagctgaaaaaggtgagggttagggtggaggtgcttgaggag TGAAGGTCAGGGTCAAGGTGTATGGCGGCTCGATTCCGGAGCGGGTTCTTGCGAGGGAGTTAAAGCGTGCGCTTGAGGTT AAGAAGACGGCGAGCGAGTTGTATGAACTTCTTTCGGAGGAGGAGCTCGATGAAATCAAAAGGGAAGTCTCAAAGAAGAG GGTCTCGTTCAGGGACTTCGGGGATATTGATTGATACGAGCGTTTTAATTGACTTGTATCATGACAGAAAGCTCGAAGAA TACTCAGGCTCGGCAATCTCAATCATCACTCTCTTTGAGTTCGTGAGGTGAATCCGCAGTGAGAGAAAGAGAGTGGAAGT TCTTAAGAGGCTGGAGAAGCTGTTCAAGGTTGAGCCCCTTGACAACGTAATAATCCTCACGGCCTCGAAAATATACAGGC ACTTGAAGAGGAAAGGAGAGCTAATCGATGACGCTGATATACTCATCGGCGCCACCGCGATAGCTAAAGGCTATACCGTG TGGACCACGAACATTGACCA