tg0102

Coordinates:92213-92959

>tg0102 lplA-like lipoate-protein ligase A related
MRFIPLIVARPEVQMAIDEAIMIARIEGKVPDTVRLYAFSPSSVTIGRFQSVVHDVNLEEAKKLNIPVVRRITGGGSVFH
DEFGEITYSVVVGENFHPALKNVETSYRYLAGPLVDALGDLGLNAGFSGLNDIVANGKKISGSAQTRRKGVILQHGTFMY
ATRVDVLGRVLRVSKAKLADKGVSSIWERVTTLEREGIKLNRWEAYELLKESFFRAFELEEGELTDYELELAEELIEKRY
GNPEWNEMK

>tg0102 lplA-like lipoate-protein ligase A related
atgcgcttcatcccgctcatagttgccaggcccgaggttcagatggcgatagacgaggcgataatgattgccagaatcga
ggggaaggttcccgacacggtaaggctttacgccttctcgccgagctccgtgacgatagggcgcttccagagcgtcgttc
acgatgtaaaccttgaggaagctaaaaagctcaacatccccgttgtcaggaggataacaggcggtgggagcgtcttccac
gacgagttcggtgagataacctattcagtcgtcgtcggcgagaactttcatccggctttgaaaaacgtcgagacgagcta
ccgctacctggccggcccgctcgtggatgctttgggggacctcgggcttaacgctggcttttctggtctcaacgacatcg
tggcaaacgggaagaagataagcggctcagcccagacgaggaggaagggtgtaatccttcagcatggcaccttcatgtac
gcgacgcgcgttgacgtgcttggtagagttctccgcgtttcgaaggcgaagctcgcagataagggcgtttcgagcatctg
ggagcgcgttacaacgctggagcgcgaggggataaagctgaaccgctgggaggcctacgagctgttgaaagagagctttt
tcagagccttcgaactcgaggagggggagcttacagactatgagcttgaactcgcggaggagctgatagagaagcgctat
ggaaaccccgagtggaacgagatgaag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 91713 - 93459 (Additional range around tg0102 is :500nt.)

>Thermococcus gammatolerans EJ3 CTAGCTCAATAGGTCAGTTTCTACGTCAATCCCTAATTCGCTGCTGAATTTGGAGCGCACGCTTTGATTCCTATCAAGTT CTAAATCCTTCCTGTACTCTCAAACCCCTGGAGTGGGGCTTCGCCCCACGTTAAGAAACTTTGCTGGGCAAAGTTTCATC AAAGTCGGCATGCCTCTTGAATGGCTTGTCTTCATGGGGGTTTACTTCCAAACTTGCCAGTTTTAAGCGTGTTTTCTCCC GTTAGCGCCCTTCGGGCGCCCTTTTAAGTTAAACACCTTCTCCAGGAGATATTGCAAGTGTAAACCCCAAATCCATTGAC TGTTTAATCACGCATGCAACTTTCCTTTTGTCCTGTTTAGATAGTTAAACCATTTTGGTCAAGCTTTGTGCAAGCAAAGG TTGCTCAGAGGTGACCGCTCTCATCACCCCTCAGGAGGGCTTAGCCTCATCATCGCTGGACTTAAAAACCCGCCAAGCCT TTTAACCCTGGTGGTGGCG atgcgcttcatcccgctcatagttgccaggcccgaggttcagatggcgatagacgaggcg ataatgattgccagaatcgaggggaaggttcccgacacggtaaggctttacgccttctcgccgagctccgtgacgatagg gcgcttccagagcgtcgttcacgatgtaaaccttgaggaagctaaaaagctcaacatccccgttgtcaggaggataacag gcggtgggagcgtcttccacgacgagttcggtgagataacctattcagtcgtcgtcggcgagaactttcatccggctttg aaaaacgtcgagacgagctaccgctacctggccggcccgctcgtggatgctttgggggacctcgggcttaacgctggctt ttctggtctcaacgacatcgtggcaaacgggaagaagataagcggctcagcccagacgaggaggaagggtgtaatccttc agcatggcaccttcatgtacgcgacgcgcgttgacgtgcttggtagagttctccgcgtttcgaaggcgaagctcgcagat aagggcgtttcgagcatctgggagcgcgttacaacgctggagcgcgaggggataaagctgaaccgctgggaggcctacga gctgttgaaagagagctttttcagagccttcgaactcgaggagggggagcttacagactatgagcttgaactcgcggagg agctgatagagaagcgctatggaaaccccgagtggaacgagatgaag TGAAACCTTATGGGCTCCCCTTCCCTTTTTCT TGCTCTCATCGAGGATTAGAATCCTTGGATTCCTTGCCAGAGCGCTCGCGAGGCCAATCCTCTGCCTCTGCCCCAGTGAG AGGTTCTTGGAGAGTAGCGTTGAGATGAAGAGCTTCTGCTTGAGCCACGCGGCCGCTTTGGTCTCGGCCCTCCTTTGGCT GGCGTTAGGGTTTTATACTTAGGCGAGAACAAGAAGCGAGGGAGCTTTATGGGAGCGACCAGGAGCGAGATTGTGGTTGA GGTTCCCAAAGGAATGAGCGTTAGCGAGATTCGGAAGATGGTGAGGGAGATTGTCCTCAGATACCTTCGAGAGAAGGGCG CGAGCGAGGAGGAGCTGAAAAAGGTGAGGGTTAGGGTGGAGGTGCTTGAGGAGTGAAGGTCAGGGTCAAGGTGTATGGCG GCTCGATTCCGGAGCGGGTTCTTGCGAGGGAGTTAAAGCGTGCGCTTGAGGTTAAGAAGACGGCGAGC