tg0109

Coordinates:98667-99509

>tg0109 SAM-dependent methyltransferase
MEDVYYLTSREARLLLASRGPVKINLDLRKTGRRWEITRDGDEFVFPDGTRVSREIMERIARDTENVYFIRKGVYKAAIA
GEHFYKLVPTIPPTIEINGIRMHRTKGTNPLQDTRSKVNAVKPREGETVLDTCMGLGYTAIEASKRGAYVITIEKDPNVI
ELARINPWSRELFTGGKIQVIQGDAFEVVKRFNDETFDVIIHDPPRFSLAGQLYSEEFYRELFRILKPGGRLFHYVGNPG
KRYRRKDLQKGVMERLRRAGFVEVKRVEEALGVVAKKPGKK

>tg0109 SAM-dependent methyltransferase
atggaggacgtctactacctgacctcgagggaggcaaggctcctgctggcttcaaggggcccggtcaaaataaacctaga
cctcaggaagacaggcagaaggtgggagataacgagggatggggatgagttcgttttcccagacgggacgagggtctcca
gggagatcatggaaagaatcgcaagggacacggagaacgtttacttcatcaggaaaggcgtttacaaggccgccatagcg
ggggaacacttctacaagctggtacctacaatccctccaacgatagagataaacggaatcaggatgcacagaacgaaggg
aacaaatcccctccaggatacgaggagcaaggtgaacgcggtgaagccgagggagggcgagacagttctcgacacctgca
tgggactcggctacacggcgatagaagcctcgaagcgcggggcttacgtcataaccatagagaaagaccccaacgtcatt
gagctggcaaggataaacccctggagcagggagctcttcaccggcggtaaaatccaggtgatccagggcgacgccttcga
ggtcgtgaagcgctttaacgacgagacatttgacgttataatccacgacccgcctcgcttttctctagccggccagctct
actctgaggagttctaccgtgagcttttcaggattttaaagccaggggggaggctcttccactacgttggcaatcccggg
aagagataccgcaggaaggaccttcagaaaggcgttatggagcggttaaggagagcgggcttcgtggaggttaagcgggt
tgaagaagcactcggcgttgtggcaaaaaaaccggggaaaaag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 98167 - 100009 (Additional range around tg0109 is :500nt.)

>Thermococcus gammatolerans EJ3 CAGCAGGGTTTTCCATTGAGAACTCTATGGCAGTGAGGGGGTCTATGACAAGGCGGGATATTTTTTCGTCCTCCGCTATC TCCCTTATCCTCAGCAGAACGCTCCGCCACGTTGGAACGTGGGCGGATTCCCTCCAGAGAACAGGGCCAAGGTCAAAGAG AAGGAGCCTTTTCGTACCGGCGTAAACCTGAACCGAGGGGTCAAAGCGCATCATGTCTTTCACGGCCTCGTGGGGGTCCT GAATGAGAGAGACGTAGGCCACCTTCTCGTTCTTCCTCGCACCCTCTATGAGAAAGTGCATTCCCATCGTGGTCTTTCCG CTACCGGGAGGGCCCGTTATCAGGTAAACCTTACCCGGGATGAGGCCGCCCTCGATGAGTTCGTCCAGTCCAGGGATGCC AGTCGAGATCCTGTCCTGAAGGGTTGACATAGTTCTGCCCCCATATGTATTAAACGGCAACGTATTAAACCTTTGCCATC AACGATCCCGGGGTGTGGAG atggaggacgtctactacctgacctcgagggaggcaaggctcctgctggcttcaagggg cccggtcaaaataaacctagacctcaggaagacaggcagaaggtgggagataacgagggatggggatgagttcgttttcc cagacgggacgagggtctccagggagatcatggaaagaatcgcaagggacacggagaacgtttacttcatcaggaaaggc gtttacaaggccgccatagcgggggaacacttctacaagctggtacctacaatccctccaacgatagagataaacggaat caggatgcacagaacgaagggaacaaatcccctccaggatacgaggagcaaggtgaacgcggtgaagccgagggagggcg agacagttctcgacacctgcatgggactcggctacacggcgatagaagcctcgaagcgcggggcttacgtcataaccata gagaaagaccccaacgtcattgagctggcaaggataaacccctggagcagggagctcttcaccggcggtaaaatccaggt gatccagggcgacgccttcgaggtcgtgaagcgctttaacgacgagacatttgacgttataatccacgacccgcctcgct tttctctagccggccagctctactctgaggagttctaccgtgagcttttcaggattttaaagccaggggggaggctcttc cactacgttggcaatcccgggaagagataccgcaggaaggaccttcagaaaggcgttatggagcggttaaggagagcggg cttcgtggaggttaagcgggttgaagaagcactcggcgttgtggcaaaaaaaccggggaaaaag TAAGGAGGAGTTAAA TCCCGCCGACTTCCTCAAGCTCCTCGAAGGCCTCCAAGTTGGTGTAGTAGTCCATGAGCTGAGCTATCTCCTTTCTCAGC TTGAAGCTCCTCACTATCGCTATTCCAAAGCCTATTATCGATGGCCATATCAGCAGGAGGAGCAGTTTGGCGTCGCCTAT CGGGATGGGCCTCGGCTCTGTAAAGCGGTTGAAGTTCCATATCATGAAGCTTATCATCAGCCACGCCGTCGAGAAGTTGG TCAAGCCACTGCCGCTTTCACCCAGCTTGAAGCCCGGGATGACGTCCTTTGTGATTGGCGGCAGGAGGTTGCTGCCCATG AAGCCGAGCTGGTCTTCGAAGACGTGCAGCCACTGACCTATCATCGAGGCCAAAGCTAGGTCACCCGCGTGGTTGTAGCC GAGGAGCTTGAAGATCGCGTAGACGAAGGCCCCTATTATGATGCCCATCGTGAGCGAGTGGCTGAAGCCGTGATGCCAGG GTAA