tg0117

Coordinates:108097-108741

>tg0117 Protein kinase, putative
MFDHLIPERIRKELLRELSGLGIEALKPYSKGTTSVVFLGKLGEKRVIVKLQRPDSPRDNFRREAEILEAISPFGISPPL
IARGRIGNLSYLVREFAEGEPILYAELKKRHLFQIAEKTALLDRLYLDHGQIQGGKHIIIGGDVYIIDFEKANWRKPNNL
TSAMAMIFIGRNAISERVYKSFNLGEDFREAMKSALRVYKREGKLSAVLDVLATL

>tg0117 Protein kinase, putative
atgttcgaccacctgataccggagcgcataaggaaggagctccttcgggagctttcagggcttggaatcgaggccctcaa
gccgtactccaagggcacaaccagcgttgtttttctcgggaagctcggagaaaagagggtaatcgtcaaactccagagac
cggattctccccgggacaacttcaggagagaggcggagatactcgaggcaatatcaccatttggaatttcgcccccgctc
atcgcccggggcaggattgggaacctgagctacctcgtccgtgagtttgcagagggcgagccgatcctttacgctgagct
caagaagaggcacctcttccagatagccgagaaaactgccctcctggacaggctttacctcgatcacggccaaatacagg
ggggcaagcacatcataattggcggggacgtttatatcatcgacttcgagaaggccaactggagaaagccgaacaacctg
acctccgcgatggctatgatcttcataggaaggaacgcgatatccgagagggtttacaaaagctttaaccttggtgagga
cttcagggaggcaatgaaaagcgccctgagagtgtacaagagggagggaaagctttcagccgtgctggacgttctggcca
ccctt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 107597 - 109241 (Additional range around tg0117 is :500nt.)

>Thermococcus gammatolerans EJ3 AGGGGTTGAACAGAACATCGATGGGCTCGACACGGAGCTTATGAAGCTCGTCTTCAAGAACGAAGATAAACTAACGTGGG GCGACGGAACCTACATCCTCAACATCGCGAGAACGCTCAGCAACATCTCGGACAAGGCCAAAGACGCCGCCGAGAGGATA AGGTTGATGATGAACAAGTGATCCCTATTTCCTCTTTGGAAGAAGAGAAGAACGAAATCAGATCGCTATCATCGTCGAGG TCATCTGGATTTCCGGCATGCGTCTTATCTTTTCCGTTATGAACTGGTCAAGGTCCTTGAGAGTATCGGTCTCAACCTTG ACAACGAGGTCGTACTCGCCGTAAACAACGTAGGCTTCTTTGACCTCGGGCATAGCAAGAAGCTTCTCCATGACTTCCCT TTCCTTTCCAGCGGCCGTAACCATCAAAATAAAAGCCGTCACCATGGGCTATCACCAAAACTATTTTATTGGAGGGGGTA TTTAAGGTTATCGAGGGCC atgttcgaccacctgataccggagcgcataaggaaggagctccttcgggagctttcaggg cttggaatcgaggccctcaagccgtactccaagggcacaaccagcgttgtttttctcgggaagctcggagaaaagagggt aatcgtcaaactccagagaccggattctccccgggacaacttcaggagagaggcggagatactcgaggcaatatcaccat ttggaatttcgcccccgctcatcgcccggggcaggattgggaacctgagctacctcgtccgtgagtttgcagagggcgag ccgatcctttacgctgagctcaagaagaggcacctcttccagatagccgagaaaactgccctcctggacaggctttacct cgatcacggccaaatacaggggggcaagcacatcataattggcggggacgtttatatcatcgacttcgagaaggccaact ggagaaagccgaacaacctgacctccgcgatggctatgatcttcataggaaggaacgcgatatccgagagggtttacaaa agctttaaccttggtgaggacttcagggaggcaatgaaaagcgccctgagagtgtacaagagggagggaaagctttcagc cgtgctggacgttctggccaccctt TGAGCGTTTAATCCTATCGTGAAGGGCCGCTATCACAGGCACGATTATGGCGAG AGTTATGAGGCCCGCCCTGGGGTCCCAGAAGTAGTCAAAGCCTAATATGACCGCTATGGCTATCCCGATCATCACGAAGA GGTCCCTGTCGTAGAGCCTTGACTTCGCGAGGATGTTCTGCTCGCGGGCTATGTACGCAAGGTAAACCGGGATCCCCATC GCCGCGAAGACCACTCCCCAGTACGTCCTCAGCGCGAGCGAGAGCACAAGTCCCGTGCTGAATATCACCGCAACGGCCGT TGTTTCCTTCATAGCCTTCACCTTCCAGCGTTATCGGCGGGCTCCTTTTAAATGTTCCCCGGGTTCAGCAATGTCCATTG AAGTTAGGCTTATATACTTCGACGCTTATCACAATCAGGTGATAGCGTTATGAGCGGTATCGAATGGAACGAGAAGACCT TTTCTCGGTTCGCCTACGTGAACGACCCGAGGATTAAAGGCTCGAG