tg0135

Coordinates:133284-134054

>tg0135 Methylthioadenosine phosphorylase (mtaP)
MPRIGIIGGSGVYGVFEPKETVKVHTPYGRPSAPVEIGEIEGVEVAFIPRHGKHHEFPPHEVPYRANIWALKELGVERVI
GITAVGSLREEYKPGDIVITDQFIDFTKKRDYTFYNGPRVAHVSMADPFCPEMRRIFYETAKELGFPVHEKGTYVCIEGP
RFSTRAESFMFRQYAHIIGMTLVPEVNLARELGMCYVNIATVTDYDVWAEKPVDAQEVLKVMAENNYKVQELLKKGIPRI
PEERNCGCADVLKTMFV

>tg0135 Methylthioadenosine phosphorylase (mtaP)
atgccgaggataggcattataggtggttccggggtttacggtgtcttcgagccgaaagaaaccgtgaaggtccacacgcc
ctacggaaggccttccgctccggtggaaatcggcgaaatcgagggcgttgaagttgccttcataccgaggcacggcaagc
accacgagttcccgccgcacgaggttccctacagggcgaacatctgggcgctcaaggagctgggagttgagagggtcata
ggcattacggcagttggctcgcttcgcgaggagtataaaccgggagacatcgtcataaccgaccagttcattgacttcac
caagaagcgcgactacaccttctacaacgggcccagggttgcccacgtctcgatggccgaccccttctgcccggagatga
ggaggatattctacgagacggccaaagaacttggcttccccgtccacgagaagggaacctacgtctgtattgaaggcccg
aggttctctactagagcggagagcttcatgtttaggcagtacgcccacataataggaatgacgctcgtcccagaggtaaa
cctggctagggagcttggaatgtgctacgtcaacatcgcaactgttacagactacgacgtctgggccgagaagccggtcg
atgcgcaagaggtcctcaaggttatggccgagaacaactacaaggttcaggagcttcttaagaagggcatcccgaggatt
cctgaggagaggaactgcggctgcgccgatgtgctgaagacgatgtttgtt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 132784 - 134554 (Additional range around tg0135 is :500nt.)

>Thermococcus gammatolerans EJ3 GTTTGGTTAGGTTGAGTTCGACGGTTTGGCCTAACTTTCCGTCCTTTAACGTTCCCACAACGATCCTGTTGTCGCTGGTG AAGTAAAGAACTATTGGTGCTGGAACGCTCTTCAGAACGTGTGAGTCCTCCTTTAGATAGGTTACCCATTCTCCGTTGCG GACCGTTGCCCCGAGAACCTTTCCGAGGGATCCTTTCTCAAGGACTGTGAGCTTTCCGTTGGGAAGGGGCTGGAGTGCGA GGGCGAACGTGGAGGGGTTTTCCATTTCCCCAGAGTGCCGCTCGTAGGCGAGGGCGATGGATGAGATAAGGAAAACGATA ACGACCGCAGCGATCCATTTTCGCTCCATGCTTATCACCTGCCGCCTAGGGATTATACTCTGCGGAGATTATATTCTTTT CGCTCTCATCCCTCATTAAGAGCACCATCTTCGATAGTACTTCTCCACCGGAAAGGCAACCCTTATATGAGTGGAGCAAG CATTTAACACGGTGATGACC atgccgaggataggcattataggtggttccggggtttacggtgtcttcgagccgaaaga aaccgtgaaggtccacacgccctacggaaggccttccgctccggtggaaatcggcgaaatcgagggcgttgaagttgcct tcataccgaggcacggcaagcaccacgagttcccgccgcacgaggttccctacagggcgaacatctgggcgctcaaggag ctgggagttgagagggtcataggcattacggcagttggctcgcttcgcgaggagtataaaccgggagacatcgtcataac cgaccagttcattgacttcaccaagaagcgcgactacaccttctacaacgggcccagggttgcccacgtctcgatggccg accccttctgcccggagatgaggaggatattctacgagacggccaaagaacttggcttccccgtccacgagaagggaacc tacgtctgtattgaaggcccgaggttctctactagagcggagagcttcatgtttaggcagtacgcccacataataggaat gacgctcgtcccagaggtaaacctggctagggagcttggaatgtgctacgtcaacatcgcaactgttacagactacgacg tctgggccgagaagccggtcgatgcgcaagaggtcctcaaggttatggccgagaacaactacaaggttcaggagcttctt aagaagggcatcccgaggattcctgaggagaggaactgcggctgcgccgatgtgctgaagacgatgtttgtt TGAGCTG GGTGGTTACTCTGTTTTCTATTTTTATGTTGAACTCTGCTTTAGCTCATCACAATTTAGCCGGGAATTTGGAAAACTTTA AAATCTTCAGTTCCCTCTTAGAGTGGTGGTCGCCGTGAGGAAAGCCCTTGCGATTGCTCCGGTGGTGTTCTTTCTCCTGA TTTCGGGGTTTGTCTCGGCCTACGAGTTCCAGGCCTATGGCTATGTAACAAAGGTGGTTGACGGCGATACAGTGTGGTTC CACTCCTACTATGGTTATAGGGCCGGAGAAACCTTCAAGGTTCGCTTCGCCGACATAAACGCTCCCGAACTCTACACGGC GGAAGGTAAGGAGTCCAAGGCTGCCCTGGAATGGCTCTTCGATACCTACGGACGTCACGTTTACCTCGACGTTGATGACG TTTACGAAACCGACCACTATGGCAGGGTTGTGGCCGTTGTGTACCTCCCCTTCTGGTATTATGGCTATGCCCTCAACGTC AACGAATGGCTG