tg0138

Coordinates:135983-136267

>tg0138 hypothetical protein TGAM_0138
MEIIVENFKPKVTRPFKRKNEYWIKLILPDGEEYIMKFKTPLEAEDAIYGMLDDLQVYGGKVKLKLREGNVIEDIEVLEL
YKPSAKELVEEYFGG

>tg0138 hypothetical protein TGAM_0138
gtggaaataatcgttgagaacttcaagcccaaggtgacgaggccgttcaagaggaagaacgagtactggatcaagctcat
ccttccggacggcgaggagtacataatgaagtttaaaacccctcttgaggcagaggacgccatttacggcatgctggacg
atcttcaggtttacgggggaaaggtaaagctcaaactccgcgagggaaacgtcatcgaggacattgaagttctggaactt
tacaagccctccgcgaaggagctcgtggaggagtactttggagga


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 135483 - 136767 (Additional range around tg0138 is :500nt.)

>Thermococcus gammatolerans EJ3 ATAACGGTCTCCCTAGACATTGGAGAAGCCCCCCTCCCCGAGGACGTGGAGGAGAGGATAGACTACCTCTTGATGAACGA GGACGAGTACAGGCGGAAGTTTGGTTCACTAGATCCAAGCCTATCAAAGGCCAAGAACCTCATAATAACGCTGAACGGCG GCGGGGCAATTGTCAGGGACCAACAGGGCAGGATAAAGGAGATCCGGGGGCTCAGCGCGAAGGTCGTGGACTCAACGGGT GCCGGCGATTCCTTCGCTGCGGGAATCATCTTCGGAGTGCTGAAGGGCTGGTCTCTGGAGGATTCCGCAAAGCTGGGCAT GTTGCTGGCCTATCTGACCGTCCAAAAGGTCGGGGCCAGGAGTGCGGTTGTGCCGCTCGAAAGGATAGTGGAGAAGAGCA GGGAGCTCAATCTGAACCTTCCGTTCGATGGGAACCCTTAAAAATTCAAAGGGCTAAAGGTTAGAGAACCTCAAGGTCAT CGAGCGCGGAGGTGATCGC gtggaaataatcgttgagaacttcaagcccaaggtgacgaggccgttcaagaggaagaac gagtactggatcaagctcatccttccggacggcgaggagtacataatgaagtttaaaacccctcttgaggcagaggacgc catttacggcatgctggacgatcttcaggtttacgggggaaaggtaaagctcaaactccgcgagggaaacgtcatcgagg acattgaagttctggaactttacaagccctccgcgaaggagctcgtggaggagtactttggagga TAAAGTCAGGAGAG GCTTTCAACGGCCTCCTCCACCCTCTGGAATATCTTTTCTTCGTCGAGCGTCAGAACCTCGCGATCCAACATCAGGATTT TGCCGTCAACTATTGTCGTCTCGACGTCGTTGCCGTTTGCGGAGTAGACAAGATGGCTAACAACGTCGTTTATCGGCCTC AGGTGAGGCTGATTGAAGTCGAAGATAACCACGTCGGCCAGATAGCCGGGCTTTATAACGCCGGCGTTGAGGCGGAGCGC TTTTGCACCATTCTGAGTGGCCATCTTGAAAACAGTCCTTGCATCTGCCACCGTCGGGTCAAGGTTGTGGACCTTGTGGA GCAACGCAGCTAACTTCATCTCCTCTACCATGTCGAGGTTGTTGTTGCTCGCCGAGCCATCGGTTCCAAGGCCGACGTTA ACCCCGGCGTTGAGAAGCCTCTGGAGAGGCATGACACCGCTGGCCAGCTTCATGTTGCTCGCTGGATTGTGTGCAACAGT GACGCC