tg0143

Coordinates:140218-140808

>tg0143 Archaeal/vacuolar-type H+-ATPase, subunit E (atpE)
MEGAELIIQEIHREAEQKIQYILSEAQREAEKLKEEARKRAQSQAEWILRKAKTQAEIEKQRIIANAKLEVRRKKLAVQE
ELIGEVLSAMREKLAALPDDEYFEALVSLTKEAIEELGTKKIVLRSNERTLKLIDSRMEEFSEKVGVEVSLGEPIECIGG
VLVESPDGTVRVDNTFDARIERLESELRATVAKALFG

>tg0143 Archaeal/vacuolar-type H+-ATPase, subunit E (atpE)
atggagggtgcagaactcatcattcaggagatacacagggaggcggagcagaagattcagtacatactcagtgaggcaca
gcgcgaagcggagaagctcaaggaggaggcgagaaagagggctcagtcccaggccgagtggatactcaggaaggctaaga
cccaggccgagatagagaagcagaggataatagcgaacgccaagcttgaggtcagaaggaaaaagctcgccgttcaggag
gagctcataggagaggttctttcggcaatgagggagaagctggccgcccttccggacgacgagtacttcgaggccctcgt
cagtctcaccaaagaggcaattgaagagctcgggaccaagaagatcgtcctccgctcgaacgagaggacgctcaagctca
ttgattccagaatggaagagttctcggagaaggtgggcgttgaggtttccttaggtgagcccatcgagtgcatcggcggc
gtcctcgtggagagcccggacggcacggttagggtggacaacacctttgacgcgaggatagagaggcttgagagcgagct
tagggctaccgttgccaaggccctcttcggg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 139718 - 141308 (Additional range around tg0143 is :500nt.)

>Thermococcus gammatolerans EJ3 CCTCGGAGCCGCCCTCGCGGCGGGACTGGCTGGGGCAGCCTCTGCCTTTGGAGTTGGTATAGCAGGTGCTGCAGCTGCAG GAGCTGTTGCAGAAGACGAGAAGAACTTCAAAAACGCGCTGATACTCGAGGGCCTGCCAATGACCCAGAGTATCTACGGC CTCATTACGCTGTTCCTGATCCTGCTCAGCGCGGGGATCATAGGCGGCGGCTTCAAGTTTGCTAAGCCCAACATGGACAA CATCGTTAAGAGCGCTATCCTGCTCGGTGCCGGTCTCACCGTCGGCCTCACGGGCCTCTCCGCTATACCGCAGGGTATCA TCGCCGGTGCCAGCATCGGTGCCGTTGCCAAGAACCCGAAGACCTTCACTCAGGGTATCATCTTTGCCGCTATGGCAGAG ACCATGGCCATCTTCGGTCTCGTCGGTGCGCTCATCATGATCGCCACCGGCGTTGGTCTCTGAGCCCCTTTCCTTTCATT ACTCGTACGGAGGAAGGAAA atggagggtgcagaactcatcattcaggagatacacagggaggcggagcagaagattca gtacatactcagtgaggcacagcgcgaagcggagaagctcaaggaggaggcgagaaagagggctcagtcccaggccgagt ggatactcaggaaggctaagacccaggccgagatagagaagcagaggataatagcgaacgccaagcttgaggtcagaagg aaaaagctcgccgttcaggaggagctcataggagaggttctttcggcaatgagggagaagctggccgcccttccggacga cgagtacttcgaggccctcgtcagtctcaccaaagaggcaattgaagagctcgggaccaagaagatcgtcctccgctcga acgagaggacgctcaagctcattgattccagaatggaagagttctcggagaaggtgggcgttgaggtttccttaggtgag cccatcgagtgcatcggcggcgtcctcgtggagagcccggacggcacggttagggtggacaacacctttgacgcgaggat agagaggcttgagagcgagcttagggctaccgttgccaaggccctcttcggg TGAGGACCATGGGAGCCGAGACAGTAA CGGCCATCCTTGACACTACTCTGGGCGTGGTCTTCACTTGGCTTGGCTGGAAGACTGCCAAGATAATCAGGAAGTACACC CCCTACTCCTACCCCAACGCGAGGATCAATGCGATGGAGGCCAAGCTGTTAACTGGGCAGAGGTTCAACGAGCTGGCCGA GAGCAGGACGCTTCAGAACTTCATCGTGAACTTGGAGGACACTGACTACAAGGTTCACCTCTCGGGCGTGACTGAGGATC CCCTTGAAATCGAGAGGGCCTTTGAGAGGGCACTCGCTTCGACGTACCTCCTGATGGAGGAGATCCTTCCGAAGAGGGTC AGCGGCTTCTTCAGGCTCCTCCTCGAGGAGTGGGACGTCAGGAACATAGCGAGCGTTGTCAAGGCAAAGGTCAGGGGAGA GCCAGCGATCGACTACGTGGTCGAGATCGGGACTATGGTACCAAAGGTCAAGGCTATTGCAGAGGCGAAGAC