tg0147

Coordinates:143992-145380

>tg0147 Archaeal/vacuolar-type H+-ATPase, subunit B (atpB)
MPGMEYSTVSKIYGPLMIVEGVKGVAYGEVVEIETESGEKRKGQVLEARENLAIVQVFEGTRDLDIKTTRVRFTGETLKV
PVSMDMLGRIFNGIGKPIDGGPEIIPEDRRDVHGAPLNPVARAYPRDFIQTGISAIDGMNTLVRGQKLPIFSGSGLPHNM
LAAQIARQAKVLGEEEQFAVVFAAMGITYEEANFFKKSFEETGAIERAVLFLNLADDPAIERIITPRMALTVAEYLAFDY
DMQVLVILTDMTNYAEALREISAAREEVPGRRGYPGYMYTDLATIYERAGRVRGKKGSITQMPILTMPDDDITHPIPDLT
GYITEGQIVLSRELHRKGIYPPIDVLPSLSRLMKDGIGKGRTREDHPQLSQQLYAAYAEGRSLRDLVAVVGEEALSETDR
KYLKFADRFEREFVAQRYDEDRSIFETLDLGWELLAELPESELKRVRKEYILKYHPKYRKRGS

>tg0147 Archaeal/vacuolar-type H+-ATPase, subunit B (atpB)
ATGCCGGGAATGGAGTACTCCACCGTTAGCAAGATTTACGGCCCGCTGATGATCGTCGAGGGCGTTAAAGGCGTAGCTTA
CGGTGAGGTCGTGGAAATAGAGACAGAGAGCGGGGAAAAGAGGAAGGGGCAGGTGCTTGAGGCCAGGGAGAACCTCGCGA
TAGTCCAGGTCTTTGAGGGAACCCGCGATTTGGACATCAAAACAACGCGCGTCCGCTTCACCGGCGAGACCCTCAAGGTT
CCGGTTTCAATGGACATGCTGGGTAGGATATTCAACGGTATCGGCAAGCCCATCGACGGTGGACCGGAAATCATCCCCGA
GGACAGGAGGGACGTTCACGGTGCACCGCTCAATCCGGTCGCGAGAGCCTACCCGAGGGACTTCATCCAGACCGGTATCT
CAGCCATAGACGGTATGAACACCCTCGTTCGCGGTCAGAAGCTGCCCATTTTCAGCGGTTCTGGTCTGCCGCACAACATG
CTGGCAGCGCAGATAGCGAGGCAGGCAAAGGTCCTCGGTGAGGAGGAGCAGTTCGCCGTCGTCTTCGCGGCGATGGGTAT
CACCTACGAGGAGGCCAACTTCTTCAAGAAGAGCTTCGAGGAGACCGGAGCAATTGAGAGGGCCGTCCTCTTCCTCAACC
TTGCCGACGACCCGGCCATCGAGCGTATCATCACCCCGCGTATGGCCCTGACCGTTGCAGAGTACCTCGCTTTCGACTAC
GACATGCAGGTTCTGGTTATCCTCACGGACATGACCAACTACGCGGAAGCTCTGCGTGAGATTTCCGCTGCTAGAGAAGA
GGTTCCAGGAAGGCGCGGATATCCGGGTTACATGTACACCGATTTGGCGACAATCTACGAGCGTGCCGGCCGTGTCAGGG
GCAAGAAGGGAAGCATAACCCAGATGCCGATCCTCACGATGCCCGACGACGACATCACCCACCCGATTCCCGATTTGACC
GGTTACATCACCGAGGGTCAGATAGTCCTCAGCAGGGAGCTCCACAGGAAGGGTATCTATCCACCAATTGACGTCCTTCC
GTCGCTCAGCCGTCTGATGAAGGACGGTATCGGTAAGGGAAGGACGAGGGAAGACCACCCGCAGCTCAGTCAGCAGCTCT
ACGCCGCCTACGCCGAGGGACGCTCCCTTAGGGACCTCGTCGCCGTCGTCGGTGAAGAAGCTTTAAGCGAGACTGACAGG
AAGTACCTCAAGTTCGCGGACAGGTTTGAGAGGGAGTTCGTCGCCCAGCGCTACGACGAGGACAGGAGCATCTTCGAGAC
CCTCGACCTCGGCTGGGAGCTCCTGGCGGAGCTTCCGGAGAGCGAGCTCAAGCGTGTCAGGAAGGAGTACATCCTCAAGT
ACCACCCCAAGTACAGGAAGAGGGGCTCT


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 143492 - 145880 (Additional range around tg0147 is :500nt.)

>Thermococcus gammatolerans EJ3 AGGCACTTCCCTGCAATCAACTGGCTGAGGAGTTACTCCCTCTACCTCGATGCCGTCCAGGACTGGTGGCATAAGAACGT TGACCCAGAATGGAGGAAGATGCGCGACACCGCTATGGCCCTCCTCCAGAAGGAGGCCGAGCTCCAGGAGATCGTTAGAA TCGTCGGTCCAGATGCACTGCCCGACAGGGAGAAGGCCATACTCATAGTCACCAGGATGCTCCGTGAGGACTACCTCCAG CAGGACGCTTTCGACGAGGTCGACACCTACTGCCCACCGAAGAAGCAGGTAACCATGATGCGTGTAATTCTCAACTTCTA CAACAGGACGATGGAGGCCGTTGACAGGGGCGTTCCCGTTGACGAGATAGCCAGGCTCCCGGTCAGGGAGAAGATCGGAC GTATGAAGTTCGAGCCCGACGTTGAGAAGATTAGGGCGCTCATAGACGAAACCAACGCCCAGTTTGAGGAGCTCTTCAAG AAGTACGGGGTGTGATGCTC ATGCCGGGAATGGAGTACTCCACCGTTAGCAAGATTTACGGCCCGCTGATGATCGTCGA GGGCGTTAAAGGCGTAGCTTACGGTGAGGTCGTGGAAATAGAGACAGAGAGCGGGGAAAAGAGGAAGGGGCAGGTGCTTG AGGCCAGGGAGAACCTCGCGATAGTCCAGGTCTTTGAGGGAACCCGCGATTTGGACATCAAAACAACGCGCGTCCGCTTC ACCGGCGAGACCCTCAAGGTTCCGGTTTCAATGGACATGCTGGGTAGGATATTCAACGGTATCGGCAAGCCCATCGACGG TGGACCGGAAATCATCCCCGAGGACAGGAGGGACGTTCACGGTGCACCGCTCAATCCGGTCGCGAGAGCCTACCCGAGGG ACTTCATCCAGACCGGTATCTCAGCCATAGACGGTATGAACACCCTCGTTCGCGGTCAGAAGCTGCCCATTTTCAGCGGT TCTGGTCTGCCGCACAACATGCTGGCAGCGCAGATAGCGAGGCAGGCAAAGGTCCTCGGTGAGGAGGAGCAGTTCGCCGT CGTCTTCGCGGCGATGGGTATCACCTACGAGGAGGCCAACTTCTTCAAGAAGAGCTTCGAGGAGACCGGAGCAATTGAGA GGGCCGTCCTCTTCCTCAACCTTGCCGACGACCCGGCCATCGAGCGTATCATCACCCCGCGTATGGCCCTGACCGTTGCA GAGTACCTCGCTTTCGACTACGACATGCAGGTTCTGGTTATCCTCACGGACATGACCAACTACGCGGAAGCTCTGCGTGA GATTTCCGCTGCTAGAGAAGAGGTTCCAGGAAGGCGCGGATATCCGGGTTACATGTACACCGATTTGGCGACAATCTACG AGCGTGCCGGCCGTGTCAGGGGCAAGAAGGGAAGCATAACCCAGATGCCGATCCTCACGATGCCCGACGACGACATCACC CACCCGATTCCCGATTTGACCGGTTACATCACCGAGGGTCAGATAGTCCTCAGCAGGGAGCTCCACAGGAAGGGTATCTA TCCACCAATTGACGTCCTTCCGTCGCTCAGCCGTCTGATGAAGGACGGTATCGGTAAGGGAAGGACGAGGGAAGACCACC CGCAGCTCAGTCAGCAGCTCTACGCCGCCTACGCCGAGGGACGCTCCCTTAGGGACCTCGTCGCCGTCGTCGGTGAAGAA GCTTTAAGCGAGACTGACAGGAAGTACCTCAAGTTCGCGGACAGGTTTGAGAGGGAGTTCGTCGCCCAGCGCTACGACGA GGACAGGAGCATCTTCGAGACCCTCGACCTCGGCTGGGAGCTCCTGGCGGAGCTTCCGGAGAGCGAGCTCAAGCGTGTCA GGAAGGAGTACATCCTCAAGTACCACCCCAAGTACAGGAAGAGGGGCTCT TAACTTTCAACTTTTTAGGTGGTCGAGAT GGCAGAACTGCTCAACGTCAAGCCTACCAGAATGGAGCTCCTCAACCTGAAGAGGCGCATCCAGTTGGCAAAGAAGGGCC ACAAGCTCCTCAAGGACAAGCAAGATGCGTTGATAATGGAGTTCTTCACCATCTACGATGAGGCCCTCCAGCTCAGACGG GAGCTCAACGAAAAGATGGGAGTGGCCTTTGAAACCCTCACGCGAGCCCAGATCGAGGCTGGAACACTTCCGCTCAGGGA AGCCGCACTGGCGGTCAAGCCCAACAAAGAGGTTGAGATAAAGCGGAGGAACGTCATGGGAGTCTCGGTTCCGCTGATCG AAGCCGAGGGCTTTAAGAGAAAGGCCAGCGAACGCGGCTACGCCTTTGTCTCGACGAGTCCATTCGTCGATATCGCAGCG GAAAAGTTCGAGGAGGTTCTTGATTTGGCCGTTCGCCTCGCCGAGGTCGAGGAGACTCTTAAGAGGCTCG