tg0150

Coordinates:147308-148135

>tg0150 P-loop ATPase, MJ1599 type
MLKCSLCVNDERTAKIDIIDGKPICRECQVYLKHPVEGERIRKELDELMKNVDKAIVAYSGGKDSVVALYLAKEVYKVPE
LEAVMIDHGLMAEEAIENARRIAEHLGVPFRVLRYDYSDIFRNALLKGQSPCRACSRRTMEKLRKYAIRKGYRYIITGHE
LPFGHHPYRLMSGGVIQIRLLSMMTEKERFEILKKLPFEFLELPGYTTNCLVLGPALELYWEKHGHSFEHRRIAALVRYG
LMSRERAEKELQKPKVPEWQWEIVKKKLGIDFPRVP

>tg0150 P-loop ATPase, MJ1599 type
atgctgaagtgctcgctctgcgttaacgatgagaggacggccaaaatagacattattgacgggaagccgatatgccgtga
atgtcaggtttacctaaagcacccggttgagggagagagaatcaggaaggaactcgacgagctcatgaagaacgttgaca
aagcgatagtcgcctactccggtggaaaggacagtgtcgtcgcactctaccttgcaaaggaggtctacaaggtcccagaa
cttgaagcggtcatgatagatcacgggctcatggcggaggaagccatagagaacgcgagacgaatagccgagcaccttgg
ggttcctttcagggttctgcggtacgactactcggacattttcaggaacgcgcttttgaagggccagagcccgtgcaggg
cctgttcgaggagaacaatggaaaaactgagaaagtacgccatcagaaagggatacaggtacataataaccggccatgag
ctacccttcggccaccatccgtataggctcatgagtggcggagtcattcaaataagactcctatcaatgatgaccgagaa
agagcgctttgaaatcctgaaaaagctccccttcgagtttctggaattgccgggctacaccaccaattgcctcgttctcg
ggcccgctctggagctctactgggaaaagcacggccacagctttgaacacaggcggatagcagccctcgtcaggtacggc
ctcatgagcagggagagggcggagaaggagcttcaaaagccaaaagtccccgagtggcagtgggaaatcgtgaagaaaaa
gcttggaatagatttcccccgagttccc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 146808 - 148635 (Additional range around tg0150 is :500nt.)

>Thermococcus gammatolerans EJ3 CCTATGGGCCTTCTGGAAGCTCAAGGACAAAACGCTGCTCGGAGCGGTTCTGGGCATTTTCACGTTCAGGAGCGGCTCAA ACCTCTCCAAAACTCTAATTTACACCGTTCACGACCAGAGGATCGTCAGGGAATACTCAAATGAGGGGAGATTGCTCTCG ATAATAGGCAGGGCCTCCACACTCTCGCTTCTCATCGAGGCCCTCTTCGTGGTAACCCTTGGCATAGCGTATAAAACCCT GTCCATAACTCTCAAATCCGGCATGAGCGCCGGAAACTTTCTCCTCTACCTCTGGGGAGCAGGCTTTCTGTTCGGGCTGC TCTTCGGGTGGTTCGTGGGAAGAAACAACCGCGGGATCCTCATGAGCAACGCCTTTCCCATCCTGGTCTTCTTCATGGCC AGAACAGGAAAGAAGAAAACCGAAGAAGTCGTCAGGAAACCCCTTGAAAGGTTCAGACGATGACCTAAGGTTTTTAACTG CTCTCTCCTTCTCCCTCCC atgctgaagtgctcgctctgcgttaacgatgagaggacggccaaaatagacattattgac gggaagccgatatgccgtgaatgtcaggtttacctaaagcacccggttgagggagagagaatcaggaaggaactcgacga gctcatgaagaacgttgacaaagcgatagtcgcctactccggtggaaaggacagtgtcgtcgcactctaccttgcaaagg aggtctacaaggtcccagaacttgaagcggtcatgatagatcacgggctcatggcggaggaagccatagagaacgcgaga cgaatagccgagcaccttggggttcctttcagggttctgcggtacgactactcggacattttcaggaacgcgcttttgaa gggccagagcccgtgcagggcctgttcgaggagaacaatggaaaaactgagaaagtacgccatcagaaagggatacaggt acataataaccggccatgagctacccttcggccaccatccgtataggctcatgagtggcggagtcattcaaataagactc ctatcaatgatgaccgagaaagagcgctttgaaatcctgaaaaagctccccttcgagtttctggaattgccgggctacac caccaattgcctcgttctcgggcccgctctggagctctactgggaaaagcacggccacagctttgaacacaggcggatag cagccctcgtcaggtacggcctcatgagcagggagagggcggagaaggagcttcaaaagccaaaagtccccgagtggcag tgggaaatcgtgaagaaaaagcttggaatagatttcccccgagttccc TAGAGCAATTCCCCGAGCTTTTTGACCGCAA TATCGAGGACTTCCCTTGGGGAAACCCTGAAGCCACCCCCCTTGGCGAGGTTGTCGCTTCCACCGCCTCCGCCGCCGACT TCCGCCAAAACGGCCCTCAAAAGCGATCTCATTGAAACGTCGAGTTTCTCGCTCTTGGCGAAGACAACGTAGTTTTCGCC CGCGATGAGTACCACCGTACCGGGGTTGTGTTCGACGAGGTAAATTGCGAAGGCCTGCGCGTCCTTCATCGGCCACTCCT CGACGAGGGTAATAACCCTGACCCCATCGATTTTCCGGGCGTTTTTGATGAGGGCCTCAGCCTTCCAGCGCCAGAGTTCA CGCCTCAGTTTTGATTTCTCCTCCTCAAGTTTTTCGAGTTCACTCCTGAGCTCAATGACTCTCTCCCTGAGGGGCCGGTT CTTGTTGGGCATCTCCTCCAAAGACCCCCAGTAGTCTTTGAGAATCTCGTTCAAAGCCCTCAAAGCCCT