tg0166

Coordinates:163611-163802

>tg0166 Nucleic acid-binding protein, containing OB-fold domain
MEVFAVEMKFEIPVCTSCGKEITPREHATHFVCPNCGEAIIWRCESCRVLSVPYKCPKCGWEGP

>tg0166 Nucleic acid-binding protein, containing OB-fold domain
ttggaggtgttcgcagtggagatgaagttcgagatacccgtatgcacctcatgcggaaaggaaataaccccaagggagca
cgccacccacttcgtctgtccgaactgcggtgaggcgataatctggcgctgcgaatcctgcagggtcctcagcgttccct
acaagtgccccaagtgcggatgggaggggccg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 163111 - 164302 (Additional range around tg0166 is :500nt.)

>Thermococcus gammatolerans EJ3 CTGAGCAAAAAAATCGGCATACCGAGGACGACGGTGCACTACAGGATAAAGAAGCTCGTTGAGGAGGGAGTTATAGAGAA GTTCACGATAAAGCCCAACTACAAGAAGCTCGACCTTGGAACCACTGCCTTCATACTGGCAAGGTACGACCCAGAATCAG GAATAAACCAGAGAGAAGTTGCCAAACGCGTTGCAACGCTCGATGGAGTCTATGAGGTGCACATAATCACGGGAGAATGG GACCTCCTGATAAAGGTCAGGGCAAAGAACTCGGAGGAGATCGGAAAGATCGTCATCGATAAACTAAGGGAGATAAAGGG GATCGGGCAAACGGTTACGATGGTTTCGTTCGTTTCGGTTAAGGAGGAGATCTGAAGGAGAGGGCGATGATTGGCGTTCT CCTTTCTGATTTTATGATGACGCGAGGTTTCCTGAGCCCTTTCGAAAGATTTATAAAAGATACCTTGAAACGGTGACCAG TGGGTAAAAACCACCTTTC ttggaggtgttcgcagtggagatgaagttcgagatacccgtatgcacctcatgcggaaag gaaataaccccaagggagcacgccacccacttcgtctgtccgaactgcggtgaggcgataatctggcgctgcgaatcctg cagggtcctcagcgttccctacaagtgccccaagtgcggatgggaggggccg TGAATTAGGAGGTGAAGAAGATGAGCG ACTACAATATGGTTGCGGTTGTTAAGGTCATGCCGACCGACCCCGAGGTCAACCTCGACGAGCTCGAGGCAAAGCTCAAG GAGGTTCTTCCCGAGAAGTTCGGTCTCGCCAAGGTCGAGCGCGAGCCCATAGCCTTCGGTCTCGTCGCCCTCAAGTTCTA CGTCCTGGCCAAGGACGAGGAGGGCTACGACCTCGACCAGGTTCTCGAGGCCTTCAGGCAGGTTGAGAACGTCGAGTCAG CTGAGGTCGAGACCGTTTCGAGGATTTAAAACCTCTTTGTTCTTCTTTGTTATCACATTCTCACAGAACTTAGCGAAAAT ATTTTTAGAAGTGGGGTTAAACTTTGTTGATGTCAAAGATTATACTAAGTGAACACGCGAAATTGCGATTAAGGGAGCGC AAAATTGAAATCGACGAAGTACATAACGTCATGGAGTTCCCAGAGATGAAGTTCTATGATTTGAAATCCGGTC