tg0177

Coordinates:170736-171020

>tg0177 hypothetical protein TGAM_0177
MPSKEEMLELIERASQELREEGVNPDILLAGPGFVEVMGELLDVLDLPVYVIKELEYDAVIADSRYLGQVRKASKRISIE
PLLVEENVWEEIRKL

>tg0177 hypothetical protein TGAM_0177
atgccgagtaaggaggagatgctcgagctcatcgagagggcctcccaggaactgagggaagagggtgtcaaccccgacat
tctcctggcgggtccgggtttcgttgaggttatgggtgagctcttggacgtgctcgaccttcccgtttacgtcataaagg
agcttgagtacgatgcggtcatagcggactctcgctacctcggacaggtaaggaaggcctcaaagaggatctccatcgag
cctctcctcgttgaggagaacgtctgggaagaaataaggaagctc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 170236 - 171520 (Additional range around tg0177 is :500nt.)

>Thermococcus gammatolerans EJ3 GAAGGCCGACGTTAAGGTAGCGAGCGTTATAGGCTTCCCGCTCGGGGCAACTCCCACCGAGGTCAAGGTCTTTGAAGCGA GGAAAGCTCTGGAAGATGGAGCTGATGAGCTTGACATGGTCATAAACATAGGCGCGCTCAAGGATGGGGACTACGACTAC GTGAAGAGGGACATAGAGGAGGTCGTCAAGGTAGCACACGAAAAGGGGGCCAAGGTCAAGGTCATAATCGAGACCTGCTA CCTCACCGAGGAGGAGAAAATCAAGGCCTGTGAGCTAGCGAAAGAAGCTGGAGCGGACTTCGTGAAAACCTCGACCGGCT TTGGAACCGGTGGTGCGACGGTCGAGGATGTAAGGCTCATGAGGAAGGTTGTGGGGCCTGAGATGGGCGTCAAAGCCGCC GGGGGAATCAGGACTTACGAACAGGCCCTCGCCATGATAGAGGCCGGTGCGAACAGGATAGGCACTTCGAGCGGTGTGAG GATCGTGGAGGGGGCAAGGA atgccgagtaaggaggagatgctcgagctcatcgagagggcctcccaggaactgaggga agagggtgtcaaccccgacattctcctggcgggtccgggtttcgttgaggttatgggtgagctcttggacgtgctcgacc ttcccgtttacgtcataaaggagcttgagtacgatgcggtcatagcggactctcgctacctcggacaggtaaggaaggcc tcaaagaggatctccatcgagcctctcctcgttgaggagaacgtctgggaagaaataaggaagctc TGATCACTTCTTT CTCTCTATTGGTTCCGGCCAGTTTTCCAGTTTTTTCACATAGAACGCCGCTCCCGTCCCAAGGATCACTCCCGTAACGAT TGAGACAGTTTTGGGGGCAAGAACCGCCTGGACATCGGTTACACCATTGATCAGAAGATACGCGTACTCGCCGCTCAGAA TTGTTATGCCCGCAAGAACGGAACCCACGAGGAGCGTCGAGAAGTCAGAACCTTTCTTTGCCAGTATCCCTGCGACCGCA CTGGCGGCTGAGCAGAGCATGAGACATAGAGCGATCTCTTCCGTTCCCGCCCCCGTCGAATAGACCGCCACTGCTATGCC AAAGGCTCCGGAGATTCCGCCTATCCAGCCGAACGTTAGACTTGAGAAGATCAGCCCCACATAGCTCAGGTCCATCCCGT TCTCTCTCACGAACGAGAGGCCCAGGGAGAGTGCAAACGAGAACGAAACGGCGGAGAGGACCAGGTTGTTGCCAACGTTA AAGTTC