tg0184

Coordinates:176495-176842

>tg0184 hypothetical protein TGAM_0184
MRRWKMGLQEEYLKAIAEGKKKIEGRLYDEKRQAIKPGDEIVFENKLVCVVKDLRVYSSFREMLEKEGLENVLPGVKSIE
EGVKVYRKFYSEEKEKKYGVVAIEVEPVAWIGEPLE

>tg0184 hypothetical protein TGAM_0184
ttgagacgctggaagatgggcctccaggaggagtacctgaaggccatagctgaaggcaagaaaaagattgaaggcagatt
gtacgacgagaagaggcaggcgataaagccgggcgacgagatagtcttcgagaacaagctcgtctgcgtcgtgaaggacc
tgagggtctactcgtccttcagggagatgctcgaaaaagagggtcttgagaacgtcctgcccggagtgaagagcatcgag
gagggcgttaaggtctacagaaagttttattccgaggagaaggagaagaagtacggcgtagttgcgatagaggtcgaacc
ggtggcgtggattggggagccgttagaa


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 175995 - 177342 (Additional range around tg0184 is :500nt.)

>Thermococcus gammatolerans EJ3 GAGATGGTTGTCCTTATCGTCACCTGTCCCCCCGGGAGGGAGGGGGACGCAATCCTCGAGCTGGAATGGGCCCTCGGCCG TGTTCGGGTAAGGGGAACTGACTGGAGGGGACTACTCGTAGCCGAAAGCCCCCTTTCAAAAGATGAGGCGATCGAGAGGC TCAAAAGATTCGAAACCCAGGCGATCCAGAGGGTTGTCCCCCTTGACCTCCTTGTTCCCGCTTCCCTTGATGTGATAGAA CAGAGGGCGATTGAGCTCATGGGAGGTAAAACCGGAACCTTTGCGGTCAGGGCAAGGGTGAGGGGGAACAAAAAGCTGAG GGAGATGGAACTTGAAAGGAAGATAGGAGAGGCCATCGTGAGGGCTTACGGCCTTAGGGTGAACCTCACCGACCCAGATT GGACCCTCGCCATCGAGGTCCTCGGGAAGAAAGCGGGCGTTGGTGTTCTAGGCAGGGGGGAGATCCTCAGGTTTAAGGTC GTTGAGTAGGGGGTGATCCT ttgagacgctggaagatgggcctccaggaggagtacctgaaggccatagctgaaggcaa gaaaaagattgaaggcagattgtacgacgagaagaggcaggcgataaagccgggcgacgagatagtcttcgagaacaagc tcgtctgcgtcgtgaaggacctgagggtctactcgtccttcagggagatgctcgaaaaagagggtcttgagaacgtcctg cccggagtgaagagcatcgaggagggcgttaaggtctacagaaagttttattccgaggagaaggagaagaagtacggcgt agttgcgatagaggtcgaaccggtggcgtggattggggagccgttagaa TGAGCCTATTTCTTGCCCTCATTTCTCGAA CTCTTTCTTAATGGCCCTAAGGTTTTCAATTGTCATCCAACATTCCTCCTCGCCCAGAATCCCCGTGATTTTCTCAAGCA CCCAAGCGTTTCCTTCCGTTTCTTCCATAACAGCACCTCCGCAAAGGCTACATAAATAAACTGCAAAAAGCGTTTTAAGG TTACAGCTTAAATGATTGGCGACAGAATCGGGATAAACCCCAAGAAAACGTGGTAGGCCCGTCATCAAGGGGACGAGGAT TCCCGTTTACTTCATACTCGAACTCCTCACAAACGGCTGGAGCTTTGAAAACCTACTTGAGAGCTATCCACAACTGACGA AAGAAGACTTAAACGCTCTTCTCAAAGGTTAAAAGAAAGAAATCACAGATACCTCTCCTTCACCCAGCGGATGAAGTAGT CCGGGTTCAGTTCCTCGCCGATGGCCTTCTTTAGGAGCTCCTTCGGCGGATAGATGCTTCCCCAGCGGT