tg0203

Coordinates:195385-195813

>tg0203 hypothetical protein TGAM_0203
MGKTFKRIFPTFLGGQMKARSLVLVLAVLAVVLGGVGYYAFNHYSFNYEWRTNLKDYKKYHLISDSTLNGYVKAEGEVSV
YILTKEDFRRLKEGEPFNYYRAWEHVEKVEFNDVKIPSGDYILVVKNEGKGMQWISVKLVDRK

>tg0203 hypothetical protein TGAM_0203
ttgggtaaaacttttaagcggattttccctacttttttgggtggtcagatgaaggccaggtcactcgttttagtcctcgc
tgttcttgcggtggttcttgggggagtgggatactatgcgttcaaccactacagcttcaactacgagtggaggactaatc
tcaaggactacaagaagtaccatctcatcagcgactcgacgctgaacggctacgtgaaggccgagggcgaggtaagcgtc
tacatcctgacgaaagaggactttaggaggctcaaagagggcgagccctttaactactacagagcctgggagcacgtgga
gaaagtggaattcaacgacgtcaagatcccgagcggagactacatcctcgtcgtcaagaacgaggggaagggcatgcagt
ggatttccgtcaagctggtggacaggaaa


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 194885 - 196313 (Additional range around tg0203 is :500nt.)

>Thermococcus gammatolerans EJ3 CCATCCGGCTCACCTGAAGGCGAGCATAGCGAACGCGCTGATTGAGCTTGCCGAACCTGATGGGGGGCCCTTCATAGACC CCTTCTGCGGCAGCGGGACGATTCCGATAGAGCTCGCTTTAAGGGGCTACGGGGGAAAGATAATCGGGCTCGAAAAGTTC AGGAAGCACCTGAACGGCGCCAAGATGAACGCCCTCTCTGCGGGGGTTTTGGAGGGGATAGAGTTCATCCTCGGCGATGC GACGAGGCTGAGCGACTACGTTGAGAGCGTCGACTTCGCGGTAAGCAATCTGCCCTACGGCCTCAAAATCGGAAGAAAGA GCGCCATTCCAAAGCTCTACATGGACTTCTTCGGAGAGCTTGCAAAGGTCTTAGAAAAGCGTGGGGTCTTCATAACGACG GAGAAGAGGGCGATAGAGCGGGCCATTGAGGAGAACGGCTTTGAAGTCAAACATCATCGCCTCATAGGCCACGGCGGGCT GATGGTGCATACCTACGTGA ttgggtaaaacttttaagcggattttccctacttttttgggtggtcagatgaaggccag gtcactcgttttagtcctcgctgttcttgcggtggttcttgggggagtgggatactatgcgttcaaccactacagcttca actacgagtggaggactaatctcaaggactacaagaagtaccatctcatcagcgactcgacgctgaacggctacgtgaag gccgagggcgaggtaagcgtctacatcctgacgaaagaggactttaggaggctcaaagagggcgagccctttaactacta cagagcctgggagcacgtggagaaagtggaattcaacgacgtcaagatcccgagcggagactacatcctcgtcgtcaaga acgaggggaagggcatgcagtggatttccgtcaagctggtggacaggaaa TAGTTTCTCTTTATTCTCCCATAGACTAT AAATCTATATAGTTTTTGTGGAGCACTATGTTTTATTGCGACAATCTTTATATTTCACATGGTCATCTTCTCATCGGTGA AGCCGATGAAACGGCTTGGGGCACTACTCCTGGTGTTCCTCCTCGGAATTGCCGTCCTGTCGAGCGGCTGCATAAACTCG AAGGGCGAAAGCACGACACCTTCGAGCACGCCCTCGAGCACCGCAACGCCAAAACAGAGCTCTACAACTTCATCTTCAAG CGCCAAGGTCATAGTAATTCGCACAACGGGAGCAACCTTCCCGCAGTATCAGATTCAGAAGTGGATTGAGGAATACATGA AGACACACCCAAACGTTAAGATTGAGTACGAGGGCGGTGGAAGCGGCCACGGGCAGGAGGCGTTTCTAAAGGGCCTTACC GACATTGGAAGGACTGATCCACCCGTCAAGGAGTCAACGTGGAAGAAGTTCCTCCAGACAGGCGACCAGC