tg0208

Coordinates:199641-200396

>tg0208 ABC-type phosphate transport system, ATPase component (pstB)
MNYAIETRNLNVYYSSNHVIKGVDLEIPEKGVFALMGPSGCGKSTMLRTFNRLIELNESAKVEGEVRLFGKNIYSPDVDP
IEVRKQVGMVFQYPNPFPHLTIYENVAIGLKLNNLLPKDEIPKRVEWALKKSALWEEVKDRLNDYPSNLSGGQRQRLVIA
RALAMKPKILLMDEPTANIDPVGTAKIEELLFELKDEYTIVLVTHSPAQAARVSDWVAFLYLGKLIEVGPTRKVFENPEH
ELTEKYVTGALG

>tg0208 ABC-type phosphate transport system, ATPase component (pstB)
gtgaactacgcgattgagacgaggaatttaaacgtctactacagctcaaaccacgtcatcaagggcgttgatctcgagat
tcccgagaagggcgtcttcgcgctcatggggccgagcggctgcggaaagtcgacgatgctgaggacgttcaacaggctga
tagagctcaacgagagcgcgaaggttgagggtgaggtcaggctcttcgggaaaaacatctactcccccgacgttgacccg
atagaggttagaaaacaggtcggcatggtcttccagtatccgaacccattcccccacctgacgatttacgagaacgttgc
catcggcctgaagctgaacaacctgctccccaaggatgagataccgaagagggtcgagtgggcccttaagaagtccgccc
tctgggaggaggtcaaagacaggctcaatgattacccctccaacctgtcgggcggccagaggcagaggctcgtaatagcg
agggccctcgctatgaaaccaaaaatcctcctgatggacgagccaacggcgaacatagacccggtcggaaccgcgaagat
tgaggagcttttgttcgagctgaaggacgaatacaccatagtcctcgttacgcattcaccagcgcaggcggcgcgcgttt
ccgactgggtggcgttcctctacctcgggaagctcattgaagtgggcccgacgaggaaggtcttcgagaatcccgagcac
gagcttaccgagaagtacgtgaccggagccctgggg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 199141 - 200896 (Additional range around tg0208 is :500nt.)

>Thermococcus gammatolerans EJ3 GAGTTCCCCACGATACTCGTTGGGGTCTTCGTGATGCAGATTCTTGTCATTCCGATGGGAACTTACTCGGCCATAGCCGG CGCGCTGGCCCTCGCGATAATCCTCACACCCTACGTCGCCGTCTACACCCACGAGGCCATGCGTGAGATACCGTTCACAT ACCGCGAGGCGGCCTTTTCGCTCGGACTCACGAGAGCGAAGGTTCTCTTCCGGGTCCTGGCGCCGATGGCGAAGCGAGGA ATACTGACGGGAGTCCTAATAGGGCTCGCCAAGGTTGCGGGGGAAACAGCACCTCTCCTCTTTACCGCTGGCGGGCTCTA CGAGAGCTATCCCGACTCAATCACGAGGCCCGTTGGGGCAATACCGCTCCTTATCTACCAGCTCGTCCAGAGCCCGAGTA AGGCCGACCACCAGACCGCGTGGGGGGCCTCGCTCGTTCTCCTGCTGATTTTCCTCGGGATATTCATACCCATAAGGCTC AGCCTTAGGGAGGTGAAACT gtgaactacgcgattgagacgaggaatttaaacgtctactacagctcaaaccacgtcat caagggcgttgatctcgagattcccgagaagggcgtcttcgcgctcatggggccgagcggctgcggaaagtcgacgatgc tgaggacgttcaacaggctgatagagctcaacgagagcgcgaaggttgagggtgaggtcaggctcttcgggaaaaacatc tactcccccgacgttgacccgatagaggttagaaaacaggtcggcatggtcttccagtatccgaacccattcccccacct gacgatttacgagaacgttgccatcggcctgaagctgaacaacctgctccccaaggatgagataccgaagagggtcgagt gggcccttaagaagtccgccctctgggaggaggtcaaagacaggctcaatgattacccctccaacctgtcgggcggccag aggcagaggctcgtaatagcgagggccctcgctatgaaaccaaaaatcctcctgatggacgagccaacggcgaacataga cccggtcggaaccgcgaagattgaggagcttttgttcgagctgaaggacgaatacaccatagtcctcgttacgcattcac cagcgcaggcggcgcgcgtttccgactgggtggcgttcctctacctcgggaagctcattgaagtgggcccgacgaggaag gtcttcgagaatcccgagcacgagcttaccgagaagtacgtgaccggagccctgggg TGATTTTGAATGAGAAAACTAC TCGATATGGGGATTGAACAGCTGAAGAAGATGATTAGGGAGATGGCGAACGGCTCGGTTGAGGCCCTCGAATCGGCGAGG AGGAGCATAGAAGGCGACTTCGACTCCGCTGAAGAGATATCGAGCAGGCTCCACATAATAAGGTCTGACGTCCTCGAGCT TGCCACTGAGTTACTCGTCCGCTACTCGCCTGTTGCGAGTGACCTGCGCTTCATCCAGAGCGCCATAGACGTCTCCTACG ACCTCTACAGGATTTCGAGGTACGCGATGGAGATAGAGAGGACGGCGAGGATCGTGAAAGGCCCCGTGGAGCTGTCGAGG AAGGCCTTTCCCCTGACGGAAGAGGCGGTTAGACTCTCAGTCGACGCCTTCAGGGAGCTCGACGAGACCCTCGTGGGAAG GCTCCTCGAGCTCGACAGGATTATCGACGACTACTACCTGCGCTCCCTCGAAGCGCTCAACGAGAACCCCGAGAAGG