tg0215

Coordinates:206023-206451

>tg0215 Nucleotide binding protein, putative, containing PIN domain
MNVFFDSNVLIYHLGGVELAKPLIESVEDGRIKGFINPIVASEVLFFYVKAKTGLKSYEIKKKPSVLADIKLEPVFELFS
LFNMLDVNSEIVKNSKRAMESYYLLPNDALIVSTCEFYGIRRIATFDEDFKRVKWLEIISNQQ

>tg0215 Nucleotide binding protein, putative, containing PIN domain
atgaacgtcttctttgattccaacgttctaatataccatctcggtggagtagaactggcaaagcccctcattgagagcgt
ggaagatggtaggattaagggattcattaatcccatcgttgcttctgaggtcctattcttttatgtaaaggccaagacag
gtttaaaatcctacgaaatcaagaaaaagccgtcagttcttgcagatatcaagcttgagcccgtctttgagctgttttca
ctcttcaacatgctcgatgtcaactcagagattgtcaaaaactcgaagagggcaatggaaagttattatctgcttcccaa
cgatgccctaatagtctcgacctgcgagttctatggaatacggagaatagcaacgtttgacgaggatttcaagcgtgtca
aatggctggagattatcagcaaccaacaa


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 205523 - 206951 (Additional range around tg0215 is :500nt.)

>Thermococcus gammatolerans EJ3 GAGGTCAAGTGGAGCGACCTGACGGCGGGAAAGGCGAGAAAAGTCCTGAGACAGCTCGAAAAGAAAGCCGAGCTCGTTGG ATTGGAGGACTACGAGAAGCACTATGGAATAATCGCAAAGAGAATCGAGGGGAAGGAAAACCTTGGGCTGGCCTTTGACC TGGGGGATTTTGACGAGGTCTTTACCAAGCGCTTAAGCAAAACGGCAGGGAGTAATGATAGCTTGAGCATCGGGGGCGAG AGCTAACTAGCCTAGATTTTTGGAAAAGGTTAAAGTTGGGATGACAAAGATTCAGTAGGGTGAGAGAATGGAAGTGGTTG TCGAAGCCGTCTATGAGAACGGCGTCCTGAAGCCTAAGAAAAAGCTCAACCTTCCTGAGGGGAGTGAGGTCAGAATTAAG ATAGTCCCAACAAGAGTGTCCGAGAGGACCTTTGGGATAGCGAAGATGAGCAAGAGGGAAATTGACGAGATAATCGAGGA GATTGAAGATGAATGGTGAG atgaacgtcttctttgattccaacgttctaatataccatctcggtggagtagaactggc aaagcccctcattgagagcgtggaagatggtaggattaagggattcattaatcccatcgttgcttctgaggtcctattct tttatgtaaaggccaagacaggtttaaaatcctacgaaatcaagaaaaagccgtcagttcttgcagatatcaagcttgag cccgtctttgagctgttttcactcttcaacatgctcgatgtcaactcagagattgtcaaaaactcgaagagggcaatgga aagttattatctgcttcccaacgatgccctaatagtctcgacctgcgagttctatggaatacggagaatagcaacgtttg acgaggatttcaagcgtgtcaaatggctggagattatcagcaaccaacaa TGAATACTCGAAAAGGAAAGCCCATAAAA ACTCCACTGCTCATCCTCATTCATGGACCGCGAAACCGAGGGAACGCTCTTAGCTCTCATCGTGCTAATCCTGCTCGGCC TCGAGCCGGTCGTAATCAAGGCCAACCCGGTTAACCCATTCGCCTTCGCCTCGCTGTCCGCCTTAATAGCCTCGCTAATC CTCTGGCCTGTTATACTTCTCAGCGGTCGGGCGAGAGAAATCCGAGAGAAGCCGGCAGAGCTGAGGAGGGCCTTTCTAAC GGGCCTTTTCGCGACGGCGATAGCCTACTCGCTGTTCTCCTACGGGACGAGACTGAGCACTGCTATAAACTCGGCAATAC TAACGCGCTTCGAGGTCTTTTATTCATTCCTCATTTCGTGGCTCCTCTTGAGGGAGAGGATAACTGGAAGAGCGGTGGCT TCGGCCCTGGCCCTAATCGCGGGCGTCTTCCTCGTGGTTGCGCAGGGAAAGAGACTAGAGATCCTGAGGG