tg0221

Coordinates:211913-212467

>tg0221 Transcription regulator, arsR family
MREVLIITEPSVVKILSEPTRFSILKLLRQRPMSVNELSDALGKDRTTIYRHVKVLEKAGLVEEIEEIGNEKVYSRTARM
FLIKVGPDESIEEFRQAYLQVEAEKLVRLLEKAGFEIQDREKLKLLAKEVLDEIEIRSQPIIKRISEANVELTEVELFHL
LNMLVFLQSCELCEKAKEARALLRF

>tg0221 Transcription regulator, arsR family
atgagggaggttttaataataaccgagccctcggtcgttaaaatcctgtccgagcccacccggttttccattttaaagct
actccgtcagaggccaatgagtgtgaacgaactcagcgacgcccttggaaaggacaggacgaccatataccggcacgtta
aggttctggagaaagctggcttggtggaggagattgaggagatagggaacgagaaggtttactcacgaaccgcgaggatg
ttcttgattaaggttgggcccgatgaaagcattgaggagttcaggcaggcctaccttcaggtagaggcggagaagcttgt
acgccttcttgaaaaagcgggctttgagatccaggatcgagagaagcttaaactccttgcgaaggaagttctcgacgaaa
ttgaaatccgctctcagccgataataaaaaggatctccgaggctaacgttgagttgaccgaggttgaactctttcacctt
ctcaatatgctggtctttctccagagttgcgaactctgcgaaaaggcaaaggaggccagggctctcctgcggttc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 211413 - 212967 (Additional range around tg0221 is :500nt.)

>Thermococcus gammatolerans EJ3 ACCAGTACAAGACCGAGATCTCCAGGGAGATAGAGGAGAACGAGGAGAAGCTCAAGGACTTCTCCAACGAGGATATAATC CACGCCATAGAGTGGCTCGCCATGGCGAAGATGGGCAGGGACGAAGAAGTTCTGGAGCTGCTTAAGAAACTTGGTGAGAT CCTGAGGAAGTAGGGGATGCTTCATGGGTAAGGGGATAAGGCTTCTCGTCCTCGATGTTCTCAAGCCCCACCAGCCCATT GTTACGGAGCTGGCGCTCGGTTTGAGTGAGCTCGAGGGAGTCGAGGGGGTCAACATAACCCTCGTGGAGATAGACAAGGA GACTGAGAACGTTAAAATAACAGTCGTTGGAGACGACCTCGACTACGAAGAGATCGTCCAGACCATAGAGGAGTTCGGGG GGGTTGTCCACAGCATCGATATGGTCGCGGCCGGCAGGCGGATAGTTGAGGAAGAGGAAACCCCTCAGGACAAGCTGGAG GAGTAAAGGGGAAGTTTGCA atgagggaggttttaataataaccgagccctcggtcgttaaaatcctgtccgagcccac ccggttttccattttaaagctactccgtcagaggccaatgagtgtgaacgaactcagcgacgcccttggaaaggacagga cgaccatataccggcacgttaaggttctggagaaagctggcttggtggaggagattgaggagatagggaacgagaaggtt tactcacgaaccgcgaggatgttcttgattaaggttgggcccgatgaaagcattgaggagttcaggcaggcctaccttca ggtagaggcggagaagcttgtacgccttcttgaaaaagcgggctttgagatccaggatcgagagaagcttaaactccttg cgaaggaagttctcgacgaaattgaaatccgctctcagccgataataaaaaggatctccgaggctaacgttgagttgacc gaggttgaactctttcaccttctcaatatgctggtctttctccagagttgcgaactctgcgaaaaggcaaaggaggccag ggctctcctgcggttc TGATTTCTCAGTGATTCCGCACTTTTTGTGCTTGGCTATTTTTCCCATTGGATGTTCAGTTAT ATCCCTCAGTGAACAGGAACGACAAAACTTAAATATTTCACCATCGGTGATACATAATGGGGGTAGTCCCCGCACTGTCG CAGGGAGGTATGGAAATGAGGAGGTACACACGGGTTTTGATCCTTTTGATGGCTCTTTTCCTCCTAGCTGGTCTTTACTA TCCTTCTGCAAGTGCCGCGAAATACTCCGAGCTTGAGCAGGGCGGAGTTATAATGCAGGCGTTCTACTGGGATGTTCCCG CTGGTGGTATCTGGTGGGACACAATACGGCAGAAGATACCCGAATGGTACGATGCCGGCATATCCGCGATCTGGATACCC CCCGCGAGCAAGGGCATGGGTGGAGCTTACTCAATGGGATACGATCCCTACGACTACTTTGATCTGGGCGAGTTCTACCA GAAAGGGACCGTTGAAACCCGCTTTGGATCCAAGGA