tg0229

Coordinates:220159-221055

>tg0229 PP-loop ATPase, mrp-like protein
MTIKTPTLNVGGLGADPLTERIKEKQKKWKYKIAVLSGKGGVGKSTVAVNLAAALAKKGYHVGLLDADIHGPNVAKMLGV
EKADVLAERMEDGRFEMLPPMNDFLGQITPIKVMSMGFLVGEDQPVIWRGPLVTKAIKQLLGDVKWGELDFMIIDFPPGT
GDEILTVVQNVQLDAAVIVTTPQEVALLDTGKAVNMMKKMEVPYIAVIENMSYLICPHCGNEIDLFGKGGGKKLAEKEGV
DFLGEVPIDLKAREASDAGIPIVLYGDTPAAKAFMEIAEKLVKKLEELKGESEEQEKTE

>tg0229 PP-loop ATPase, mrp-like protein
atgacgatcaagactccaacgctcaacgtcggaggtctcggtgcggaccccctcaccgagaggataaaggagaagcagaa
aaagtggaagtacaagatagcagttctgagcggtaagggcggcgttggaaagagtaccgtcgcggtaaacttggcagctg
ccctcgcaaagaaaggttatcacgttggcctgctcgatgccgacatacacggaccgaacgtcgccaagatgctgggcgtt
gagaaggccgatgttttggcggagcgcatggaagacggtcgcttcgagatgctcccaccgatgaacgactttctcggtca
gataacaccgatcaaggttatgagcatgggctttctcgtcggcgaggatcagccggtaatctggcgcggtcccctcgtta
caaaggccatcaaacagctcctcggcgatgtcaagtggggcgagctcgacttcatgatcattgacttcccgcctggaacg
ggcgatgagattctcacagtcgttcagaacgtccagctcgatgcagcggttatagtcactacgccacaggaagttgccct
gctcgatacgggcaaggcagtaaacatgatgaagaaaatggaagtgccttacatagctgtaattgagaacatgagctacc
tcatctgcccccactgcggcaacgagatcgacctcttcggtaaaggtggtggcaaaaagctggccgagaaggagggagtt
gacttccttggtgaagtccccattgacctcaaggcaagggaagcaagcgacgccggaatcccgatagtcctctacggcga
caccccagcggcaaaggccttcatggagatagcagagaagctcgtaaagaaacttgaggagctcaagggcgaaagcgagg
agcaggagaaaaccgag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 219659 - 221555 (Additional range around tg0229 is :500nt.)

>Thermococcus gammatolerans EJ3 TATTCGGCAGGGCCGACGAGGTGCTGAACGTTTCGGGTCACAGGATTGGAACGGCCGAGATAGAGCATGCATTGGTTCTC CACCCAGCCGTTGCAGAAGCGGCGGTAATCGGCAGGCCAGACGAGATTAAGGGTGAGGTGCCAGTTGCCTTCGTAATCCT CAAGGAGAACGTCGTCCCGAGTGAGGGCCTGAAGAAGGAGCTCATAGACTACGTCAGGGAAACCCTCGGCCCAATAGCGG CCCCAGCGGAAGTGTTCTTCGTTAACAAACTGCCGAAGACGAGGAGCGGGAAGATAATGCGCAGGGTTCTAAAGGCCCTC GCCAGTGGAAAGGGCCTCGGCGACCTCTCGACGCTCGAAGACGAGGCGAGCGTGGAAGAGGTGAAAAAGGCTCTTGAAGG CTTTGAGATGCGCTGATTTTACCCATTTTTGACCACTACTGTCACTTTCCTGGACAAAGCTTTTTAAGTCTAAAAATCAA CCTGAGCTGGTGGTATGAA atgacgatcaagactccaacgctcaacgtcggaggtctcggtgcggaccccctcaccgag aggataaaggagaagcagaaaaagtggaagtacaagatagcagttctgagcggtaagggcggcgttggaaagagtaccgt cgcggtaaacttggcagctgccctcgcaaagaaaggttatcacgttggcctgctcgatgccgacatacacggaccgaacg tcgccaagatgctgggcgttgagaaggccgatgttttggcggagcgcatggaagacggtcgcttcgagatgctcccaccg atgaacgactttctcggtcagataacaccgatcaaggttatgagcatgggctttctcgtcggcgaggatcagccggtaat ctggcgcggtcccctcgttacaaaggccatcaaacagctcctcggcgatgtcaagtggggcgagctcgacttcatgatca ttgacttcccgcctggaacgggcgatgagattctcacagtcgttcagaacgtccagctcgatgcagcggttatagtcact acgccacaggaagttgccctgctcgatacgggcaaggcagtaaacatgatgaagaaaatggaagtgccttacatagctgt aattgagaacatgagctacctcatctgcccccactgcggcaacgagatcgacctcttcggtaaaggtggtggcaaaaagc tggccgagaaggagggagttgacttccttggtgaagtccccattgacctcaaggcaagggaagcaagcgacgccggaatc ccgatagtcctctacggcgacaccccagcggcaaaggccttcatggagatagcagagaagctcgtaaagaaacttgagga gctcaagggcgaaagcgaggagcaggagaaaaccgag TGATCCGAGTGATTTTTAAATTCCCATACCTATTCTTTTTTA GAGCGCGGCTCAGGCCGGCGGGGACCGTTGCGATGGGGCCGCGCTGGACCAGGCTACATTAAGTTTTTAATGAATTATCC CTATTGCCCTAGGGGATCAAATGAGAAAGAGCACCGAGGCGGCGTTAATAGTGATCCTGATAGGCCTTGTAACGGCACTC TTACTCATGAATCCAGTCTCAGCGGAAGGCACTTTTCACATGAGGTCGCAGGGAGTGACGTTTTCCCCCATCAGACTCGC CCTCTTCCTAGGAGCGGCCCTCACGACCGTTGTCCTCGTTACCCTTCATCTGGAGGGATCGGGTGAGTATGCACACATCT TCTACCTCCTCTCAGTCTCAACTATCACGATATGGATTGTGAACTCAGGAGTTCCGGATATGAGCTCATTTCTGGCCGTT ATTCGAGATTTGTACAACAGGATCGGGATTCAACGTTCGATCCCAGTGGAAACGGCGT