tg0235

Coordinates:225877-226794

>tg0235 hypothetical protein TGAM_0235
MRRETRTLLLLTFLSPFLAEVLGGSTHPLQLVVQPLSFPFLWLFYGSGVLLIREAWVRFGGGQAGLMLLGALYGVVEEGV
IIRSWFDPDWPDLGALRDYGRVFGVNASWAVLLTIYHTTMSIAIPILVVELLYPELRGKSLIGKRGVLLTTLAFCASAFA
FAHLTSYVPSPAQYSVALFSALALLLLARKFGSIDVPFTPAHPFILGFLSGAMIFTSLAFLPKALPPLATSTVGTLALVL
FFASLNGDEKRAVLGFLAFWLIIYDILLELVGVIGEAILGPLSYVFLFRRLGAVDRASTDQHQAER

>tg0235 hypothetical protein TGAM_0235
atgagacgagagacccgaacactattactccttacctttctctcacctttcttggccgaagttctcggtggttcaacaca
tccgctccagctggtggttcaaccactctcttttcctttcctctggctcttctacggttctggcgttctcctgattcgcg
aagcgtgggtgaggttcggtggtggacaggctggactcatgctcttaggcgccctctacggcgtcgtcgaggaaggagtt
ataatccgttcatggttcgacccagactggcctgacctcggagctctcagagactacggcagggtcttcggcgtgaacgc
gagctgggccgttctcctgacaatctaccacaccacgatgagcatagctattccaattttggtagtggaactgctctatc
ccgaacttcgcggaaagtctctcattggaaaacgaggagtcctactgaccacactcgctttctgcgcctcggcctttgcc
ttcgcacacctcaccagctatgtcccttcccctgcgcagtattcagtggccctcttctctgctctcgcgctcttacttct
cgccagaaagtttgggagcattgatgttcccttcacaccagcgcatccatttatccttggctttctttcgggagcaatga
ttttcacgagccttgcattcctccccaaggcccttccaccgctcgcaaccagcacagttggaacgctcgccctcgtcctg
ttcttcgcttcccttaacggggacgagaaaagggccgtactcggctttttggcgttctggttgataatctatgatatcct
gctcgagcttgttggtgtcatcggtgaggcgatactcggcccgctgagctacgttttcctcttcagacgtctaggcgcgg
tagatcgggccagcacagaccaacaccaagccgagcgg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 225377 - 227294 (Additional range around tg0235 is :500nt.)

>Thermococcus gammatolerans EJ3 GGAAATCAGCGACGCCCTCATCGAACTCCTGACGATAACGCGCTGGGATGAGCTCGACTACCTCGTCATTGACATGCCAC CTGGACTCGGCGACCAGCTGTTGGATGTCCTCCGCTTCCTCAAGAGGGGTGAGTTCCTGGTCGTTGCAACCCCGTCGAAG CTCGCCCTCAACGTCGTGGAAAAGCTCATCCAGCTCCTTCTTGAGGAGAATCACAAAGTCCTCGGCGTCGTTGAGAACAT GAAGCTCGATGAGGAGGAAGACGTCAAGAAGCTCGCAGAGCGCCACAACGTCCCATACCTTGTCGGCATACCGTTCTACC CAGAGCTTGACGCAAAGGTCGGCAACGTCGAGGAGCTCATGAAGACGGAGTTCGCGGAGAAGATAAGGGAGCTTGCTGAG AAGCTGTGATTTCTCTTCTTTTGTTCCAATGTTTTATTTTTGCCAGTTAACTCCAGAAAGTTCACGCATAAAGTTTTAAC CGAGAAGGAAAGTTTAGCCT atgagacgagagacccgaacactattactccttacctttctctcacctttcttggccga agttctcggtggttcaacacatccgctccagctggtggttcaaccactctcttttcctttcctctggctcttctacggtt ctggcgttctcctgattcgcgaagcgtgggtgaggttcggtggtggacaggctggactcatgctcttaggcgccctctac ggcgtcgtcgaggaaggagttataatccgttcatggttcgacccagactggcctgacctcggagctctcagagactacgg cagggtcttcggcgtgaacgcgagctgggccgttctcctgacaatctaccacaccacgatgagcatagctattccaattt tggtagtggaactgctctatcccgaacttcgcggaaagtctctcattggaaaacgaggagtcctactgaccacactcgct ttctgcgcctcggcctttgccttcgcacacctcaccagctatgtcccttcccctgcgcagtattcagtggccctcttctc tgctctcgcgctcttacttctcgccagaaagtttgggagcattgatgttcccttcacaccagcgcatccatttatccttg gctttctttcgggagcaatgattttcacgagccttgcattcctccccaaggcccttccaccgctcgcaaccagcacagtt ggaacgctcgccctcgtcctgttcttcgcttcccttaacggggacgagaaaagggccgtactcggctttttggcgttctg gttgataatctatgatatcctgctcgagcttgttggtgtcatcggtgaggcgatactcggcccgctgagctacgttttcc tcttcagacgtctaggcgcggtagatcgggccagcacagaccaacaccaagccgagcgg TGATAAAGGTCATCTTTTAA ATTCTGCCTCCAATCAAAAACTAGAGACCAAAGAGCCTTCTTATTGAGTGCTAAATTCTTTTTGATATGGCCTGCAATGA GAAACGCTGATTTTGTTATCTCAAAAACATGAAGTACTTCTTCATTTCAACAACAAAGCGGTTAAAATTTTAAGGCCGAA GAATGAATTCATGGGGAAGTTCTGGGGTGAAAATATGAACCTCGAAGAACTCTTCCAGAATGCAAAAAGAGTTGTCATAT GTGGAATCGGGAACGACATCAGGGGAGATGACGCCTTCGGCGTTCTGGTCGCGGAGAGGCTGAAGGAGTTGCTCGACAAC CCCGACGTCCTCGTGCTGAACTGCGGGGAGGTTCCGGAGAACTACACTGGTAAGATAGCGAACTTTAAGCCCGACCTGGT GGTTTTCGTGGATGCTGTTGATTTCGGCGGTGAAGTCGGCGAGTACATCACAGCCGACCCGGAGGGAACGCTCGGCGAG