tg0242

Coordinates:229735-230565

>tg0242 formate hydrogenlyase I subunit H (Mhy1H)
MMGRRLKSVWVYHVDAGSCNGCDIEVLDVLSPYYDLERLGVKVVPNPRHADALFITGPLTRQTRIALKKAYEAMPPKPRI
VVAVGTCASSGGIFYNSYALYNTSPQRGRDRLRSGGPEMIVPIDMYIPGCPPSPEEILYGVAQLLGIKEKKMKGEYWIAL
PPKETPSKENEVEFRIPDRPIPLRYWLTLREELRRVIGYYDREAVLNDFMALVEKAFEDENPREKLHDLVTGYFLKEKDS
RVKVAMRFLENEFWRLYDEYHSLGEALRKKYPVTAGV

>tg0242 formate hydrogenlyase I subunit H (Mhy1H)
gtgatgggaagaaggctcaagtcggtctgggtctatcacgttgatgcgggctcatgtaacggctgtgacatcgaggtgct
cgatgtactcagcccctactacgacctcgagaggctcggtgtcaaggtcgtccccaacccgaggcacgcggatgcgctct
tcatcaccggtccgcttacaaggcaaacgaggatagcgctcaagaaggcctacgaggctatgccccccaagccgaggata
gtggttgccgtgggtacgtgcgcctcgagcggtggaatcttctacaacagctacgccctctacaacacctccccccagcg
cggaagagacaggctcaggagcggtgggccggagatgatagtgccgatagacatgtacatccccggctgtccgccgagtc
cggaggagatactctacggcgtggcccagctcctcggcatcaaggagaagaagatgaagggcgaatactggattgcgctc
ccgccgaaggagacaccgagcaaagagaacgaggtcgagttcagaatccccgacaggccgataccgctccgctactggct
cacccttcgcgaggagctcaggcgcgtcataggctactacgacagggaagcggttctcaacgacttcatggcgttggtcg
agaaggccttcgaggatgagaacccgagggagaagctccacgacctcgtcacgggatacttcctcaaggagaaggactcc
agggtaaaggtcgccatgcgcttcctcgaaaacgagttctggaggctgtacgacgagtatcactctctcggagaggccct
caggaagaagtaccccgtgacggcgggtgtc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 229235 - 231065 (Additional range around tg0242 is :500nt.)

>Thermococcus gammatolerans EJ3 TTGATATCGAGAAGCCACCCGAGTACAGGGGAATCCCGCACATCAACCCCGAGAAGTGCATAGGCTGTGGAGCCTGTGTC AACGCCTGCCCGCCCGATGCCCTAATCCTCGAGTGGGACAAGGAGCACGGCGTTAAGAGGCTCACCTTCAACGCGGCGAG ATGTATAAGGTGCCACCGCTGTGTTGAGGTCTGCCCGACTGGAGCTATGGAACCGACTAACATCTTCGAGATAGCAACCG ACAACAAGGAGGACCTCGTTGAAGTAGTGGAGCACAAGCTGGCCTACTGCGAGGAGTGTGGTGAGTACCTCGACTTCACA GAGAGGCAGATTGAGTACGTTAAGGCGATTCTGCCCAAGGAAATCATCGATATGTACGCCCTTGAAGACAGAATCGGCCT GACCCAGGAGGCAAAGATGCGCAAGACCGTCGAGAAGCTCAGGGAAACCGAGGGCAACGCATATCCAGCGTTCATACTCG TGAAGAAGGGGGGTGAGGA gtgatgggaagaaggctcaagtcggtctgggtctatcacgttgatgcgggctcatgtaac ggctgtgacatcgaggtgctcgatgtactcagcccctactacgacctcgagaggctcggtgtcaaggtcgtccccaaccc gaggcacgcggatgcgctcttcatcaccggtccgcttacaaggcaaacgaggatagcgctcaagaaggcctacgaggcta tgccccccaagccgaggatagtggttgccgtgggtacgtgcgcctcgagcggtggaatcttctacaacagctacgccctc tacaacacctccccccagcgcggaagagacaggctcaggagcggtgggccggagatgatagtgccgatagacatgtacat ccccggctgtccgccgagtccggaggagatactctacggcgtggcccagctcctcggcatcaaggagaagaagatgaagg gcgaatactggattgcgctcccgccgaaggagacaccgagcaaagagaacgaggtcgagttcagaatccccgacaggccg ataccgctccgctactggctcacccttcgcgaggagctcaggcgcgtcataggctactacgacagggaagcggttctcaa cgacttcatggcgttggtcgagaaggccttcgaggatgagaacccgagggagaagctccacgacctcgtcacgggatact tcctcaaggagaaggactccagggtaaaggtcgccatgcgcttcctcgaaaacgagttctggaggctgtacgacgagtat cactctctcggagaggccctcaggaagaagtaccccgtgacggcgggtgtc TGAGATGCCCTGGAAGCTCTACCGCTTC AAGTACGAGGACTACCCCGAGTATTCGGCCAGGATTACGGGCCACTACGCAGGCGACCTGCTAATCATCGAGGAGGAGGG CGAGCTGAGCGAAGAGGCCGTGAAGCTCATAAAGTCCGCTCTCGGAATAGACGAGAACACGAGGGCCTTCGACATTGAAG TCAGAGACGTGCTGAGGCTCCCGATTAAAGAGTTGCCCGAGAAGGACAGGAAGGTCCTGCTTGAAGCGGCTGAAAAGCTC GACTCCGAGAGCAAGCTCCACATCGAGTACCGCTACCAGCCGACCTTCGATTAAACTTTTATTTTTCCAGGACTTTTCTC AGGTGGTGGTGAGATGAACGAGGCAAAGCTAAAGATGGCCAAGGAGGAGTTGATAAAGAGGGTCAAGGAGTTCTACGGGG ACAACCTTCTCTCGATAGTCTTCTACGGGAGGCACCTCCGCGACCCGGACTTTCCAGAGATAGACGTTGTCG