tg0245

Coordinates:232972-233886

>tg0245 formate hydrogenlyase I subunit E (Mhy1E)
METTIKVGFELVGILIIFLLPPYLDGIARRVKARLQYRRGPPLMQTWYDLQKLFNLPSVKPTKSLLFTAAPFLALASAIS
AALLLPYGNVIPVDFGFNLVVFFYVILMVSVFLILGGLSVQNAFSHIGATREAQLILTVEPLIAILYGVLAYNAGSLNIA
DIIANLHLTPSLVLAYIALAYALYVESGFVPFDVAEAEQEVIGGPLGEYSGRLLGVFYYAIHIKRFALLWFFVSLLTMPW
IGPINTPERAALVLALQFILTVAFYPIIAALEATNARLRIDQVVKMNVRMFFAGLVILGMAFMGW

>tg0245 formate hydrogenlyase I subunit E (Mhy1E)
atggagacaacgatcaaagttggattcgagctcgttgggatcctcatcatcttcctcctgccgccgtaccttgacggaat
agcgagaagggtcaaggcgagactccagtacaggcgcgggccgccgctcatgcagacctggtacgacctccagaagctct
tcaaccttccatccgttaagccaacgaaaagcttactcttcaccgcagccccgttcctggccctggcctctgctatctca
gcagcactgctcctgccctacgggaacgtcataccagtggacttcggcttcaacttggtggtgttcttctacgtaatcct
gatggtcagcgtcttcctgatcctcgggggcctgagcgtccagaacgccttcagccacataggagctaccagagaggccc
agctcatcctaacggtggaaccgctcatagccattctctacggcgtccttgcttacaacgccggctcccttaacatagcg
gacatcatagccaacctgcatctcacaccgtcgctcgtgctcgcgtacatagcccttgcctacgcgctctacgttgagag
cggctttgtcccattcgacgttgcggaggcagagcaggaagtcataggcggtccgctgggtgagtacagcggaaggctcc
tcggggtcttctactacgcgatacacatcaagcgcttcgccctgctgtggttcttcgtcagcctgctaacgatgccttgg
atcgggccgataaacaccccagagagagcggcgctcgtactggccctccagttcatcctcaccgttgcattctatccgat
catagcggccctcgaagcgacaaacgcaaggctgagaatagaccaggtcgtgaagatgaacgttaggatgttcttcgccg
gcttggtgatcctgggcatggcgttcatggggtgg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 232472 - 234386 (Additional range around tg0245 is :500nt.)

>Thermococcus gammatolerans EJ3 CTCTTCTCGCCGGTGATCTTTGTGATACTCCTCGGCGCACTCGCGGCTGCCCTGTACCTGACCTTCAAGCCAGAGTTCGG AAAGGAAACGAAGCCCTGGGACTGCGGTTCAACAGAAATAGACGAGGACGAGTACAGGACGAACGCCGAGGGCTACTACA ACTGGTACGAGAAGAAGATAGGCTCTTTCTATCGCCTCGGCGACTGGTTCTACACCGTTGGAGCTGGAGTAATCCACTAC ATAACCAGGGCTTACCTCTGGATGGCGAGCTACTTCACCAAGGTAGTCGACACCCCGTACACAAAGGTTGAGACCCTCGA CGACCTCCGCGAGAGGGAGATAATGAACATAGACGAGGAGGCCCTCAAACCGTTGCTCAGACTGCTCAGGATCGTCAAGA ACGTCCTGCCAGGAATGAGACTTGGAACTTTCGTGGTACTGACCCTGGTAGTCATCGGGGCCGTGATAGGAATCCTGATA GCCCTGTGAGGTGATGGAA atggagacaacgatcaaagttggattcgagctcgttgggatcctcatcatcttcctcctg ccgccgtaccttgacggaatagcgagaagggtcaaggcgagactccagtacaggcgcgggccgccgctcatgcagacctg gtacgacctccagaagctcttcaaccttccatccgttaagccaacgaaaagcttactcttcaccgcagccccgttcctgg ccctggcctctgctatctcagcagcactgctcctgccctacgggaacgtcataccagtggacttcggcttcaacttggtg gtgttcttctacgtaatcctgatggtcagcgtcttcctgatcctcgggggcctgagcgtccagaacgccttcagccacat aggagctaccagagaggcccagctcatcctaacggtggaaccgctcatagccattctctacggcgtccttgcttacaacg ccggctcccttaacatagcggacatcatagccaacctgcatctcacaccgtcgctcgtgctcgcgtacatagcccttgcc tacgcgctctacgttgagagcggctttgtcccattcgacgttgcggaggcagagcaggaagtcataggcggtccgctggg tgagtacagcggaaggctcctcggggtcttctactacgcgatacacatcaagcgcttcgccctgctgtggttcttcgtca gcctgctaacgatgccttggatcgggccgataaacaccccagagagagcggcgctcgtactggccctccagttcatcctc accgttgcattctatccgatcatagcggccctcgaagcgacaaacgcaaggctgagaatagaccaggtcgtgaagatgaa cgttaggatgttcttcgccggcttggtgatcctgggcatggcgttcatggggtgg TGAATATGGTAACGACGAGGGATT TGGAGGCTCACTTCGAGTTTGAGTGCAGGGCCTGCGAAAACGGCCACTGCAGGAAGGCTGATGTCGAGACAATTCTTACC GAGAGAAAGGGCCTGAAGGAGTTTTACGAGGCCTTCAAAGAGCATATTAGAGAGTGCAAGAGGATGACCTACGGGCAGTA CATGTTTGTCATTGACAGGGAAGTTCTTCCGGATGCGGTCCTCTGGTGGCACAACCACCCTGAGTTCAAGGAGACACACC TTTCAACCGCCGTCGGAACCGACGAGAGGCCACTCAACGGCAAGTTCGTCTACATGCCCTTCCTCAACGTCCAGGTTGAA CCGCAGAACATGGACGAGAACTACTGGGTCTTCCTCAAGGCCTACATGCCCGCCGACGACCCGAGCTTCCCGAGCGTGGC AGCAAAGCTCCCCGCGGCGCTCTGGATAGAGAGGGAAGTCAAGGACCTGCTCGGCTTCAACCCAGTTGGCCACCCA