tg0250

Coordinates:240074-240664

>tg0250 Transcription regulator, TetR family
MVTKSPGKTREKLVSAAMELFAKKGFDKTTVDEIVARAGVAKGTFYLYFKSKDDLIKELAFEVMPIMAMPSLNDPYITVS
FPTLESYLLQLGREFLSFYSENYRAEIFFHMLSVRERMKSIDDIYHQACSELLREGARRITAYVKVGFEDALIAFQVFLA
SLMHYLHAGDCLGFSREHYLKKAVDVVLNHLRLSASV

>tg0250 Transcription regulator, TetR family
atggtcacaaagtcccccggtaaaacccgcgagaagctcgtttccgcggcaatggagctcttcgcgaagaagggctttga
taaaacgacggtagacgagatagtcgccagggcgggagttgccaaggggacgttttacctatacttcaagagcaaggacg
acctcataaaagagctcgccttcgaggtaatgcccataatggccatgccgtccttaaacgacccttacattactgtttcg
ttcccgacacttgagagctaccttctccagcttgggagagagttccttagcttttattcagagaactaccgggcggagat
cttcttccacatgctctcggttcgcgagaggatgaagagcattgacgatatctatcaccaagcctgctcggagcttttaa
gggaaggagcgaggagaattactgcttacgttaaagtgggttttgaggacgcgctcatagcgtttcaggtgtttttagcc
tctttgatgcactatctccatgcaggggattgtctgggcttttcaagggagcactatctcaagaaggccgttgacgtcgt
ccttaaccaccttcgtctctcggccagtgtt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 239574 - 241164 (Additional range around tg0250 is :500nt.)

>Thermococcus gammatolerans EJ3 GCATGGAGGACATGATGAAGCAGATGGTCAAAGGAGTGAAGAGCAAACACGGATTTGAGGAAACCCTCGAGAGGATTAAG AAAAAGGTTGACGAGCTGGGCTGGAGCGTTATCGGGGAGTATGACTTCACTGAAAAGCTCGGAATAAGGTTTGCAATCGT TGAAATCTGCAACAAGGAGTTCGCAAAGAAGGCCCTCGAAAAGCCCGAGAACCGCTGGATTTCAGCCATGATGCCGTGCA AGTTCTCCATAATAGAGATGCCTGACGGTGTGTACGTCTTCGGTATGAACATGGGGCTTTTCGCAAAGATAGTTCCTGGA GAGCTCGGGGAACTCCTCTCAGAGGTCGCAAAGGTAGATGAGGAGCTAATTAATTCGGTTCTGTGATTTTACAGACTCTT TTTTGTTCTCTATGTTATGTCCACCGAGCGGAAAGTTTAAATTCCCTTCTGCACATAGCTGTCCATAAGGAAATGACCGT GTAGTCAGAAGGGATGGGA atggtcacaaagtcccccggtaaaacccgcgagaagctcgtttccgcggcaatggagctc ttcgcgaagaagggctttgataaaacgacggtagacgagatagtcgccagggcgggagttgccaaggggacgttttacct atacttcaagagcaaggacgacctcataaaagagctcgccttcgaggtaatgcccataatggccatgccgtccttaaacg acccttacattactgtttcgttcccgacacttgagagctaccttctccagcttgggagagagttccttagcttttattca gagaactaccgggcggagatcttcttccacatgctctcggttcgcgagaggatgaagagcattgacgatatctatcacca agcctgctcggagcttttaagggaaggagcgaggagaattactgcttacgttaaagtgggttttgaggacgcgctcatag cgtttcaggtgtttttagcctctttgatgcactatctccatgcaggggattgtctgggcttttcaagggagcactatctc aagaaggccgttgacgtcgtccttaaccaccttcgtctctcggccagtgtt TGAAACACCCATTTAACACAGTTTTCCA CATTAGTTCATTCTGTTTCGGCCATTGCAGAAAACTATTTAAGGTCTTGACGTTCATTCTAAATGACTGGTCAGTCATTA GAAGGGTGATAGCCATGGCAGAGAAACTCGTACCTGTTGTATGCCCCTGGTGTTCAGTCGGCTGTCGCTTCTACGCGGTC AGCGTTAACGGCTACATCAGGAAGATCGAGTTCGACTACGACCACCCCACCGTCAACCGCGGAAAGCTCTGCCCCAAGGG CGTTGCTTCCTACCAGTTCATCAACAGCTCTAAGAGACTCAAGAAGCCGCTCAAGCGCGTTGGAGAGAGGGGAGAAGGGA AGTTCGAGGAGATAAGCTGGGATGAGGCCTACAGGATAATCGCAGAGAAAATCAAGGAAATCAAGGAGACCTATGGCCCC GAGGCAATAGCCTTCCTCGGAAGCGAGAAGATAACCCTCGAGGAGAACTACCTCGTCCACAAGCTGTCAAAG