tg0251

Coordinates:240781-241161

>tg0251 hypothetical protein TGAM_0251
MEDMMKQMVKGVKSKHGFEETLERIKKKVDELGWSVIGEYDFTEKLGIRFAIVEICNKEFAKKALEKPENRWISAMMPCK
FSIIEMPDGVYVFGMNMGLFAKIVPGELGELLSEVAKVDEELINSVL

>tg0251 hypothetical protein TGAM_0251
atggaggacatgatgaagcagatggtcaaaggagtgaagagcaaacacggatttgaggaaaccctcgagaggattaagaa
aaaggttgacgagctgggctggagcgttatcggggagtatgacttcactgaaaagctcggaataaggtttgcaatcgttg
aaatctgcaacaaggagttcgcaaagaaggccctcgaaaagcccgagaaccgctggatttcagccatgatgccgtgcaag
ttctccataatagagatgcctgacggtgtgtacgtcttcggtatgaacatggggcttttcgcaaagatagttcctggaga
gctcggggaactcctctcagaggtcgcaaaggtagatgaggagctaattaattcggttctg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 240281 - 241661 (Additional range around tg0251 is :500nt.)

>Thermococcus gammatolerans EJ3 CGTATTCACCGGGCTTGACATCGGGCATCAAATCAATCCTCGCCTCTCTCTTAACGCCCCCGAAGTCAACCCACGCGGTT CCCTTCTCCCTGTTAACTTCCAAAACCTTAGCGACGGTTGCCAAGCACATGAGCTTCACCTACCCAGGGTTCTCGACCGG GTTATTTAGGCCTATCTAAAACTTCAGGTTTGAAACCGTGAAGGTCAGTTCGAGTTTGCTCGAGCGGTGGTAGGAGCACC TCGCAAGGGTCTCCTCAGCCTCTTCTCTCGTGACCTTCTCAAGGACTATGCCGTAGTAAATCTTTACGTAGTCCCCAGGT TTCACGTTCCTCACGAAGTCCAGCTTTGCTTCTCTGAGCTGGCCATCAACGTCGACTATCGCCTTTCCATCCCTGACTTC AACGACCCTTCCAGCTAACATCAGGGCCATGGTTACCAACCAAAGGTGAAGGAAAACGATTTATAGACCTTTTCCTGACC AGTCAGTCAGGTGACTGGC atggaggacatgatgaagcagatggtcaaaggagtgaagagcaaacacggatttgaggaa accctcgagaggattaagaaaaaggttgacgagctgggctggagcgttatcggggagtatgacttcactgaaaagctcgg aataaggtttgcaatcgttgaaatctgcaacaaggagttcgcaaagaaggccctcgaaaagcccgagaaccgctggattt cagccatgatgccgtgcaagttctccataatagagatgcctgacggtgtgtacgtcttcggtatgaacatggggcttttc gcaaagatagttcctggagagctcggggaactcctctcagaggtcgcaaaggtagatgaggagctaattaattcggttct g TGATTTTACAGACTCTTTTTTGTTCTCTATGTTATGTCCACCGAGCGGAAAGTTTAAATTCCCTTCTGCACATAGCTG TCCATAAGGAAATGACCGTGTAGTCAGAAGGGATGGGAATGGTCACAAAGTCCCCCGGTAAAACCCGCGAGAAGCTCGTT TCCGCGGCAATGGAGCTCTTCGCGAAGAAGGGCTTTGATAAAACGACGGTAGACGAGATAGTCGCCAGGGCGGGAGTTGC CAAGGGGACGTTTTACCTATACTTCAAGAGCAAGGACGACCTCATAAAAGAGCTCGCCTTCGAGGTAATGCCCATAATGG CCATGCCGTCCTTAAACGACCCTTACATTACTGTTTCGTTCCCGACACTTGAGAGCTACCTTCTCCAGCTTGGGAGAGAG TTCCTTAGCTTTTATTCAGAGAACTACCGGGCGGAGATCTTCTTCCACATGCTCTCGGTTCGCGAGAGGATGAAGAGCAT TGACGATATCTATCACCAAGCC