tg0252

Coordinates:241231-241482

>tg0252 [NiFe] hydrogenase maturation protein (hypC)
MALMLAGRVVEVRDGKAIVDVDGQLREAKLDFVRNVKPGDYVKIYYGIVLEKVTREEAEETLARCSYHRSSKLELTFTVS
NLKF

>tg0252 [NiFe] hydrogenase maturation protein (hypC)
atggccctgatgttagctggaagggtcgttgaagtcagggatggaaaggcgatagtcgacgttgatggccagctcagaga
agcaaagctggacttcgtgaggaacgtgaaacctggggactacgtaaagatttactacggcatagtccttgagaaggtca
cgagagaagaggctgaggagacccttgcgaggtgctcctaccaccgctcgagcaaactcgaactgaccttcacggtttca
aacctgaagttt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 240731 - 241982 (Additional range around tg0252 is :500nt.)

>Thermococcus gammatolerans EJ3 TTCCGCTCGGTGGACATAACATAGAGAACAAAAAAGAGTCTGTAAAATCACAGAACCGAATTAATTAGCTCCTCATCTAC CTTTGCGACCTCTGAGAGGAGTTCCCCGAGCTCTCCAGGAACTATCTTTGCGAAAAGCCCCATGTTCATACCGAAGACGT ACACACCGTCAGGCATCTCTATTATGGAGAACTTGCACGGCATCATGGCTGAAATCCAGCGGTTCTCGGGCTTTTCGAGG GCCTTCTTTGCGAACTCCTTGTTGCAGATTTCAACGATTGCAAACCTTATTCCGAGCTTTTCAGTGAAGTCATACTCCCC GATAACGCTCCAGCCCAGCTCGTCAACCTTTTTCTTAATCCTCTCGAGGGTTTCCTCAAATCCGTGTTTGCTCTTCACTC CTTTGACCATCTGCTTCATCATGTCCTCCATGCCAGTCACCTGACTGACTGGTCAGGAAAAGGTCTATAAATCGTTTTCC TTCACCTTTGGTTGGTAACC atggccctgatgttagctggaagggtcgttgaagtcagggatggaaaggcgatagtcga cgttgatggccagctcagagaagcaaagctggacttcgtgaggaacgtgaaacctggggactacgtaaagatttactacg gcatagtccttgagaaggtcacgagagaagaggctgaggagacccttgcgaggtgctcctaccaccgctcgagcaaactc gaactgaccttcacggtttcaaacctgaagttt TAGATAGGCCTAAATAACCCGGTCGAGAACCCTGGGTAGGTGAAGC TCATGTGCTTGGCAACCGTCGCTAAGGTTTTGGAAGTTAACAGGGAGAAGGGAACCGCGTGGGTTGACTTCGGGGGCGTT AAGAGAGAGGCGAGGATTGATTTGATGCCCGATGTCAAGCCCGGTGAATACGTGCTTATTCACACGGGTTTCATAATAGA GAAGGTTGACGAGCAAACGGCCAAGGAGATACTGAGCGCCTGGGAGGAGGTCTTCAAAGCCGAGGAAAACGCACTTGGAG GTTACTACTACCCGGGTGATTGAGATGAGCCTGCAGTCGGTTCTTGCCCCCTACAGGGACAGAGAGATAGCTCAAAAGCT CGTGGAGAAAATCAAGGAAGAGGCAAAAACCCTCGACGGCGAGATAAGGATAATGCACGTCTGCGGGACTCACGAGGACA CGATTACCCGCTCTGGAATTCGCTCGCTCCTTCCAGAGAACGTTAAAGTAGTC