tg0257

Coordinates:245599-245922

>tg0257 Nucleotide binding protein, putative, containing PIN domain
MTVIDTNVVMRRVKTGEEISENITEVTAVEYPPVLSYRKFNGEILLITRRTVAIAIELQRKLREIGKPKQFADLMIAAIC
IANGEKLITYDSDFKDIADVSELEVEVL

>tg0257 Nucleotide binding protein, putative, containing PIN domain
atgacagttattgacaccaacgtggtcatgagacgagtcaagacaggagaagaaatatcggaaaacatcacggaggtcac
tgccgttgagtatcctcccgttttaagctatcgaaagtttaacggagaaatcctcctgataacacgcaggacagtggcga
tagccatagagctccagagaaagcttagagaaattggaaaaccaaagcagttcgcggaccttatgatagcggccatttgt
atagccaacggcgagaagctcataacttatgattccgatttcaaggacatcgctgatgtttcagaactggaggtggaggt
tctc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 245099 - 246422 (Additional range around tg0257 is :500nt.)

>Thermococcus gammatolerans EJ3 CATTGAGAAGGCCAGGGAATTCGGCGTGAAGGACGTCGTGATGAGCGGAGGTGTTGCCTACAACGAGCTGATAGTGAAAA CCGTGAGGAAGGCGGTTGAGGCGTCGGGCCTTAGGTTCCACGTTACAACCGAAGTCCCGAGGGGGGACAACGGGATAAAC GTCGGCCAGGCCTTCCTCGGCGGACTTTACTTAGAGGGCTATCTGACGAAGGAGGATTTGATGCTGTGAAGGTTTAAGTG TGGAACGACCCAAATAGATGCGGTGGGAGTCATGGGGAAGGTCATCACGATTAGGGTTCCGGACTGGATTGGCGACGACT TCATCAAACGGATAGAGCGTATGGTTGAAGAAGAGATAGAGAGGGCCTTCGCCTCCGGTAGGGTGGATAGGGAGACGTAC CTCCGTTTCGTCGAGACCTATAGCACTACCAAGGACGTTCTCCTCGAAAACGATGAGGAACTGCTCGCTGAGATGAGAAA AAAGGAAAAGGCGAGGATAA atgacagttattgacaccaacgtggtcatgagacgagtcaagacaggagaagaaatatc ggaaaacatcacggaggtcactgccgttgagtatcctcccgttttaagctatcgaaagtttaacggagaaatcctcctga taacacgcaggacagtggcgatagccatagagctccagagaaagcttagagaaattggaaaaccaaagcagttcgcggac cttatgatagcggccatttgtatagccaacggcgagaagctcataacttatgattccgatttcaaggacatcgctgatgt ttcagaactggaggtggaggttctc TAATGCCCGTAATCCCGAGGGAAGAGCTCCTCGAAATCCTACGCGAGGTGAAGG AAAGGCTGAGAGATATCCTCGGCGACGACTTAGTCGAGGTCATCCTCTTCGGCTCGTACGCGAGGGGTGAGGCAAGGGAA GACAGCGACGTTGACGTTTTAGTCGTAGTCAGGAGAAGGGTAACACTCGAAGAGTACGACAGACTCAGTGAAATTACAGA GAAATACGTTCTGGAGAAAGGGTTAGTTATCTCGCTCATCGTTTATCCTATCAGTCCGGGAATGGAACACGACCCGCTGA TTCAGAACGTTCACGTGGAGGGTATCAAAGTATGAACAAATACGAGGAAATGCTGAAAAAAGCCCACGAGAGTCTTGAGG CGTCGAAAACGTTGCTGGAGAAGGGATTTTATGCCTTCGCGCTCTCACGGGCCTATTACACGATGTTCTACTGCGCCGAG GCGATTCTGCTGACAAAGGGAATAAGCGTCTCAAAGCACTCTGCA