tg0264

Coordinates:250295-251227

>tg0264 Ketoisovalerate oxidoreductase subunit vorB (vorB)
MEIPESIKKRLTIPAEEHFFAGHTACQGCGASLGLRYVLKAYGKKTIVVIPACCSTIIAGAWPYNTLDANLFHTAFETTG
AVISGIEAALKARGIKVKGEDGVMVVGWAGDGGTADIGLQALSGFLERGHDAVYIMYDNEAYMNTGIQRSSSTPYGAWTT
NTPGGKMHFLEKRHKKKVIDIVIAHEVPYAATASVAFPEDFIRKLKKARKIPGPSFIQLFSPCPTGWRSPTDKSIEIARL
AVQTAYFPLFEYENGKYKINMPSPKKEPKPIEEFLKLQGRFKYMTREDIENLQAWVLREWEKLKKLAEVFG

>tg0264 Ketoisovalerate oxidoreductase subunit vorB (vorB)
atggagatccccgagagcattaagaaaaggttgaccattcccgctgaggagcacttctttgccggccacaccgcctgtca
gggttgcggtgcttcactcggactgcgttacgtcctcaaggcttacggcaaaaagacgattgttgtcatccccgcgtgct
gttcaaccatcatagccggggcgtggccctacaacaccctcgacgccaacctcttccacaccgcctttgagacgactgga
gccgtcataagcggtatcgaggccgctctgaaggcgaggggaataaaggtcaagggcgaagatggggtaatggtcgtcgg
ctgggccggcgacggtggtaccgccgacataggccttcaggctttgagcggattccttgagaggggccacgacgccgttt
acataatgtacgacaacgaggcctacatgaacacgggaattcagcgctcaagctctaccccctacggagcctggacgacg
aacacccctggaggaaagatgcacttcctcgagaagaggcacaagaagaaggtcatcgacatcgtcatagcgcacgaggt
tccctacgctgcgaccgcgagcgttgcgtttccagaggacttcataaggaagctcaagaaggccagaaagataccgggac
cgagcttcatccagctctttagcccgtgcccgacgggctggcgctcgccgaccgacaagagcatcgagatagcaaggctc
gccgttcagacggcttacttcccgctcttcgagtacgagaacgggaagtacaagatcaacatgccctcacccaagaagga
gccgaagccgattgaggagttcctcaagctccagggtcgctttaagtacatgaccagggaggacatcgagaacctccaag
cctgggtgctccgcgaatgggagaagctgaagaagctcgccgaggtgttcggc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 249795 - 251727 (Additional range around tg0264 is :500nt.)

>Thermococcus gammatolerans EJ3 AAGATGCGAAGAAGGTCATCAAGGACGTCGGTAAGGAGTTCGGCGAGCGCTTCGGCAGGGACTACAGCGAGATGATTGAG AAGGGCTACGTTGACGATGCGGACTTCGTTTTCATGGGCATGGGCTCCCTCATGGGAACCGTTAAAGAAGCAGTAGACCT GCTCAGAAAAGAGGGCTACAAGGTCGGCTACGCGAAAGTTAGATGGTTCCGCCCGTTCCCGAAGGAGGAACTCCTTGAGA TAGCCGAGAGCGTTAAGGGCATAGCCGTCCTTGACAGGAACTTCTCCTTCGGCCAGGAGGGCATACTCTTCAACGAGGCG AAGGGCGTTCTCTACAACACATCAGCGAGGCCGATAATGAAGAACTACATCGTCGGACTCGGTGGCAGGGACTTCACCGT TCCTGACGTCAAGGCCATAGCCGAGGACATGAAGAGAGTTATCGAGGCAGGAAAGCTCGATAGAGAGGTTGAGTGGTACC ACCTCAAGAGGTGAGAATG atggagatccccgagagcattaagaaaaggttgaccattcccgctgaggagcacttcttt gccggccacaccgcctgtcagggttgcggtgcttcactcggactgcgttacgtcctcaaggcttacggcaaaaagacgat tgttgtcatccccgcgtgctgttcaaccatcatagccggggcgtggccctacaacaccctcgacgccaacctcttccaca ccgcctttgagacgactggagccgtcataagcggtatcgaggccgctctgaaggcgaggggaataaaggtcaagggcgaa gatggggtaatggtcgtcggctgggccggcgacggtggtaccgccgacataggccttcaggctttgagcggattccttga gaggggccacgacgccgtttacataatgtacgacaacgaggcctacatgaacacgggaattcagcgctcaagctctaccc cctacggagcctggacgacgaacacccctggaggaaagatgcacttcctcgagaagaggcacaagaagaaggtcatcgac atcgtcatagcgcacgaggttccctacgctgcgaccgcgagcgttgcgtttccagaggacttcataaggaagctcaagaa ggccagaaagataccgggaccgagcttcatccagctctttagcccgtgcccgacgggctggcgctcgccgaccgacaaga gcatcgagatagcaaggctcgccgttcagacggcttacttcccgctcttcgagtacgagaacgggaagtacaagatcaac atgccctcacccaagaaggagccgaagccgattgaggagttcctcaagctccagggtcgctttaagtacatgaccaggga ggacatcgagaacctccaagcctgggtgctccgcgaatgggagaagctgaagaagctcgccgaggtgttcggc TGAGCC CGTAACTTTTAAGTTTTGTGCTGATAACTCACTCGAGGTGATAAATATGGCTGAGAGCCCGTTTAAGGCCGACATTGAGA GGGTTCAGAAGGAGTATAGCGAAAAGATGACTCCGGGAGCTATTGCCTACATCCCGGGGAGTAGCGTAATCAACAAGACC GGCTCGTGGAGAGTCTTCATGCCCGAGTTCTACAGGGACAAGTGCGTTCGCTGCTACCTCTGCTACATCTACTGCCCCGA GCCTGCCATCTACCTCGACGAGGAGAACTACCCGGTCTTCGACTACGACTACTGTAAGGGTTGTGGAATCTGCGCGAACG AGTGCCCGACCGATGCTATAGTTATGGTTAGGGAGAGCAAGTGAGGTGGTGAAAGATGCCGATTAGAACCGTTATGAAGG CGAACGAAGCCGCTGCGTGGGCCGCGAAGCTTGCCAAGCCGAAGGTCATAGCGGCCTTCCCGATTACACCGTCAACCCTA GTTCCCGAGAAGAT