tg0266

Coordinates:252425-252739

>tg0266 Ketoisovalerate oxidoreductase subunit vorD (vorD)
MNTLFGEKKTEAKKIVFTSVDQYPEAPISLATTLSNFTGDWRTFIPVIIEEKCVKCYICWKFCPEPAIYIREDGYVGIDY
DYCKGCGICANECPTNAITMEKEEK

>tg0266 Ketoisovalerate oxidoreductase subunit vorD (vorD)
ttgaacacgctgtttggtgagaaaaagaccgaggcaaagaagatcgtcttcacatcggttgatcagtatcctgaggcacc
aataagcctcgccacaacgctaagcaacttcaccggtgactggaggacgttcatcccggtaataatcgaagagaagtgcg
tcaagtgctacatctgctggaagttctgcccggagccagcaatctacatccgtgaggacggctacgttggcatagactac
gactactgtaagggttgtggaatctgcgcgaacgagtgcccgaccaacgccataacgatggagaaggaggagaag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 251925 - 253239 (Additional range around tg0266 is :500nt.)

>Thermococcus gammatolerans EJ3 CCAAGCATTCCCCTTCTTCGGTGTTGAGAGGCGTGGAGCACCGGTTACAGCTTTCACAAGAATAGACGACAAGCCGATAA GGATAAAGACCCAGATCTATGAGCCGGACATCGTCGTAGTGCTCGATCCAAGCCTTCTGGAGACTGTAGATGTTACGGCC GGTCTCAAAGATGGCGGGATCGTTATCATAAACACGGAGAAGAGCAAGGAGGAAGTCCTTGAAAAACTCAAGAAGAAGCC GGGCAAGCTGGCCCTCGTCGACGCGACCAGCATAGCCCTCGAGGTTCTCGGCCTTCCAATCACGAACACGGCCATCCTTG GAGCGGTCGCGAAGGCAACCGGCCTAGTGAAGCTCGAGAGCGTTCAGGAGGCAATTAAGGAGACCTTCTCCGGAGCCCTC GGCGAGAAGAACGCCAAGGCAGCCGAGGAAGCCTTCAACAAGACCACTGTCTACGAGCTCTAATTTTACTTTAACCCTTT TGAGGAGGAGGGGAGGAGT ttgaacacgctgtttggtgagaaaaagaccgaggcaaagaagatcgtcttcacatcggtt gatcagtatcctgaggcaccaataagcctcgccacaacgctaagcaacttcaccggtgactggaggacgttcatcccggt aataatcgaagagaagtgcgtcaagtgctacatctgctggaagttctgcccggagccagcaatctacatccgtgaggacg gctacgttggcatagactacgactactgtaagggttgtggaatctgcgcgaacgagtgcccgaccaacgccataacgatg gagaaggaggagaag TGATATGGCCGAGTACAAGCCTATTAGAAAGGTTGTGAGCGGAAACTACGCGGCCGCTTACGCG GTGAAGCACGCGCGCGTTCAGGTCGTCGCCGCTTACCCAATCACCCCTCAGACGAGCATCATCGAGAAGATAGCCGAGTT CATAGCGAACGGGGAGGCCGATATTCAGTACGTTCCCGTCGAAAGCGAGCACTCGGCCATGGCCGCGAGCATTGGAGCTT CAGCCGCCGGTGCAAGAGCCTTTACCGCTACCTCCGCCCAAGGTCTCGCTCTGATGCACGAGATGCTTCACTGGGCAAGC GGTGCGAGGCTTCCCGTCGTCATGGTCAACGTTAACCGTGCCATGGCTCCCCCGTGGAGCGTCTGGGACGACCAGACAGA CAGCCTCGCCCAGCGCGATACTGGCTGGATGCAGTTCTACGCGGAAAACAACCAGGAAGTCTACGACGGCGTCCTGATGT CCTTCAAGGTAGCCGAGACCGTTAACGTGCCCGCGA