tg0270

Coordinates:255880-256821

>tg0270 hypothetical protein TGAM_0270
MVKIKRSWLIIVLIFALLVGYGFSVYRELKTPEVYATYDLVVERYVSYLSWPEEEIKSGPFTFEFRGPEFIPYRDSRSVP
VPLIFRVFTCQEPDDPQPVNYTIDIWYTVYNGTSVPSFMTLSDVVPVGNISGEDVFMFFINYTLDDKGEAFQLGIAPKGG
QVSFSRGDGTVWSLKDIGAFVDTDGFSGSSTCYLPESELPPLRYLGRITVVATDHRLPETVVAVLSVNGSRIVKGGRIGF
LAVMRMGLRKRHLGISRWHGVPYLTTVDTRKTLTLCSYLGDDYPEPDGYIFAIPVSSYDISVDRSTSTNLFNRG

>tg0270 hypothetical protein TGAM_0270
atggtcaagattaaaagaagctggctcatcattgttcttattttcgctctgctggttggttatggcttttctgtataccg
tgaattgaaaaccccagaagtatacgccacctatgacttggttgttgagaggtatgtctcttacctttcttggcctgagg
aggaaataaaatccggaccctttacttttgaatttaggggacctgagtttatcccataccgggactctcgcagcgtcccc
gttccgctgatcttccgtgttttcacttgtcaagagccggatgatccgcagccggtgaactataccatagacatctggta
cacggtatataacggaacatccgttccaagtttcatgaccctctctgacgtggttcctgtggggaacatcagtggtgagg
atgttttcatgttcttcatcaactacaccctcgatgacaagggggaggcctttcaactcggcatcgcccccaaaggaggt
caagtctcattttccagaggggatggaaccgtctggtccctcaaggacattggggcctttgttgacaccgatgggttctc
tggcagttccacctgttaccttccggaaagcgagctcccacctcttcgttaccttggcaggatcaccgtcgttgcgaccg
atcacaggcttccggaaactgtggtagcagtcctctccgtaaacggaagcaggatagtgaagggtgggaggatcgggttc
cttgcggtgatgaggatgggcctgagaaaaaggcacctcggcatctcccgctggcatggagtaccctatctaaccaccgt
tgacacgcgaaagaccctcaccctctgctcttacttgggggacgattaccctgaacctgatgggtacatttttgctattc
ccgtgtcctcttatgacatctctgttgatcgttccacttccacaaacctttttaaccggggt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 255380 - 257321 (Additional range around tg0270 is :500nt.)

>Thermococcus gammatolerans EJ3 CGAGTTTTATCCTCCGTATTGCCTCCTTAACGAGTGGAACCTCGTACTGAAGACTTGCAAGTTCGACCTGAAGTTTGGCC TCCTTGGAGTGAGCCCTCTTTTCAAATATCTCCAGCACGAGCTGCCACCTGTCTAGGATTTCAACACGGAGCTCCTTCCA GAGGTTGTAGGCCTGAGAAGGGGTTAAACGGTTTGCAAAGATCACCTTGTCAGGTCTGAGCTCCTTGACGAGCTCTTTGA GCTCCTCGAGCTTTCCCCTTCCGATGTTGTAGCGAGGGTGCTCCTCCCGGTTCTGCTCAAGAACGGCAAGAACCTCATAA CCCGCGCTCCTCAAGAGCTCCTCGAACTCCTCCCTGCTGAGCCTCTCCCTTCGCGAGTACCTTATGACACCTATAGCCTT CATATCTCTCATCTTCAGTTTGCTGGAGTGTTTAAAAAGTCATCTCTTACTATCGCAAGACTTATAAACTCCTTAAAATT CTCAGAGTTGGTGAGTACTA atggtcaagattaaaagaagctggctcatcattgttcttattttcgctctgctggttgg ttatggcttttctgtataccgtgaattgaaaaccccagaagtatacgccacctatgacttggttgttgagaggtatgtct cttacctttcttggcctgaggaggaaataaaatccggaccctttacttttgaatttaggggacctgagtttatcccatac cgggactctcgcagcgtccccgttccgctgatcttccgtgttttcacttgtcaagagccggatgatccgcagccggtgaa ctataccatagacatctggtacacggtatataacggaacatccgttccaagtttcatgaccctctctgacgtggttcctg tggggaacatcagtggtgaggatgttttcatgttcttcatcaactacaccctcgatgacaagggggaggcctttcaactc ggcatcgcccccaaaggaggtcaagtctcattttccagaggggatggaaccgtctggtccctcaaggacattggggcctt tgttgacaccgatgggttctctggcagttccacctgttaccttccggaaagcgagctcccacctcttcgttaccttggca ggatcaccgtcgttgcgaccgatcacaggcttccggaaactgtggtagcagtcctctccgtaaacggaagcaggatagtg aagggtgggaggatcgggttccttgcggtgatgaggatgggcctgagaaaaaggcacctcggcatctcccgctggcatgg agtaccctatctaaccaccgttgacacgcgaaagaccctcaccctctgctcttacttgggggacgattaccctgaacctg atgggtacatttttgctattcccgtgtcctcttatgacatctctgttgatcgttccacttccacaaacctttttaaccgg ggt TGATATTGGCCGTGTGTATGATAGCCCTTGGTATTGAGGGAACGGCCCATACCCTCGGCATAGGAATCGTTACTGA GAAAAAAGTCCTCGCAAACGTATTCGACACTCTCACCACCGAAAAGGGCGGAATCCACCCGAAGGAAGCGGCAGAGCACC ATGCCCGGCTCTTAAAGCCCCTCCTCAGAAAGGCCCTTCAGACGGCTGGAATAACGATGGAGGACGTTGACGTCATAGCC TTCTCCCAAGGCCCCGGTCTTGGGCCGGCTTTGAGAGTTGTCGCCACAGCCGCGAGGGCCCTGGCCATAAAGTACAACAA GCCGATAGTCGGCGTCAACCACTGCATAGCCCACGTCGAGATAACCAAGATGTTCGGCGTTAAGGATCCCGTTGGACTCT ACGTCAGCGGTGGAAACACCCAGGTTTTGGCCCTTGAAGGCGGCCGCTACCGCGTTTTCGGCGAGACCCTCGACATTGGA ATAGGAAACGCGATAGACACCTT