tg0273

Coordinates:258590-259066

>tg0273 Phosphopantetheine adenylyltransferase (coaD)
MRKPYRKVVVGGTFDRLHLGHKALLRKAFEVGRYVYVGLTSDEMIRNKPYAEKILPYELRLMDLLKFFEVNGYTNYRIIK
INTAIGFADRIKSLEAIVVSEETYKGALLVNRAREERGLKPLEIVTIKLVKSRIGPKISSTLIRAGLIDPFGNPLKKDN

>tg0273 Phosphopantetheine adenylyltransferase (coaD)
atgagaaagccctaccgcaaggttgtggttggtgggacatttgacaggcttcatctgggccacaaggccctcttgaggaa
ggcctttgaagtcggccgctacgtttacgtcggcttaacatcggacgagatgatcaggaacaagccctacgccgagaaga
tccttccctacgagcttcgcctcatggatcttctcaagttctttgaggtgaacggttacaccaactaccgcatcattaag
ataaacaccgcaatcggctttgcggacagaataaaaagccttgaggccattgttgtgagtgaagaaacctacaagggcgc
cctccttgtgaatcgggcccgtgaggagaggggcctcaaaccccttgagatagtgacgataaagctcgtgaagagccgga
tcgggccgaagataagctccaccttgatacgggccggcctcatcgatcccttcgggaaccccctaaagaaggataat


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 258090 - 259566 (Additional range around tg0273 is :500nt.)

>Thermococcus gammatolerans EJ3 TTCTAGAGGAAAGTTATCTACATTTCAGGCTCTCGTCCTACTCATCCCATACAAAGGCAGCGGCAGAGCTCAAGGGGGCC TACATTGCCCTTGGCTCCAAATCTAAGTTTGTGGATGTGATGGAACTCATAAAATCGGCAAAGTTACCAACGCTCGTCTT CACGAGGAACCCCCACCTCTATCAGGGGATGGAGTTCGTGGTTCCGGTCTGGGTGACCCAGGCAACGGATCAGGGGATTT CCCCGACGAAGCTTCACGTGATTCAGGAGCACGCACTCAAGTTCATTCGCAAGAACCCGAACGCGATCGTGCTCATTGAC TGCCTGGAGTACCTGCTCCTCTACAACGATTTCGCAGCCGTTTACAAGTTTCTCATCAACCTGAAGGATTACCTGATCCC CGCGGGTGCCGCGCTTATAGTCATTGTCGATGAGAGCGCCCTTGACGAGAGGCAGCGTGCGCTTCTCCTGAGGGAGTTTG AACCCCTGTGAGGGTCCGCC atgagaaagccctaccgcaaggttgtggttggtgggacatttgacaggcttcatctggg ccacaaggccctcttgaggaaggcctttgaagtcggccgctacgtttacgtcggcttaacatcggacgagatgatcagga acaagccctacgccgagaagatccttccctacgagcttcgcctcatggatcttctcaagttctttgaggtgaacggttac accaactaccgcatcattaagataaacaccgcaatcggctttgcggacagaataaaaagccttgaggccattgttgtgag tgaagaaacctacaagggcgccctccttgtgaatcgggcccgtgaggagaggggcctcaaaccccttgagatagtgacga taaagctcgtgaagagccggatcgggccgaagataagctccaccttgatacgggccggcctcatcgatcccttcgggaac cccctaaagaaggataat TAGAGGCCAGTCGGCTCGTCTATGAAGAAGACATCGAGACCAAAGCGCTCCCTAATGAGCT CCATCAGGGCCTTAACGCCGAGGGTCTCCGTCTTGTAGTGCCCCGCAACCAAAACGCTCTGGGGCAGGTCGATTGCTGTT AAGTAATCCGCGTGGCCGAATTCCCCCGTTATCAGGAGGTCTATCCCCTTTCTGTAGGCTTCTTCCAAGGCGAAGGCACC GGCGCCGCTTATCGCACCAACTGTTTTAATAACTCTCCTCCCGAACTCGTAGGTTCTAACTGTTGTGTCGAGCTTTTCCG CTATTATTTGGGCAACTTTCTCAATCGGCTGAGGTTCTTCAAACTCGCCGTAGAAGCCTATGCTCAGGCTTTTGTACTCG CCGAAGGGCCCTTTGGGCTCTAAATCGAGCAGGCGGAGCAGGCCGACGTTGTTGCCGACTTCTGGGTGCGCATCGAGGGG CAGATGTGCCACGTAGAGGTTCAGGCCGTTCTCGATTA