tg0279

Coordinates:264215-264715

>tg0279 Ribosome subunit biogenesis protein, putative
MSETLRYRRASAWEYDLILREAEKYGELKHHFFAVVEGKFRDVYAVNERVWAEIEKFRVKPYAYGTFVGTIKVDNLVEKF
YPNVEFFYFVNVEKNYAVLSPKAGFLFTTGKDVPRSGVRKYVWQGTKKLVIYDENGVILGIGRINAESRKKFILNVTDVG
EFLRRKR

>tg0279 Ribosome subunit biogenesis protein, putative
atgagtgagacccttcgctaccgccgtgcctcggcatgggagtacgacctaatcctccgcgaggccgagaagtacggcga
gttaaagcaccattttttcgccgtcgttgaaggtaaattcagggacgtttacgccgtcaacgagagggtgtgggcggaaa
tagagaagtttagggtaaagccctacgcctacgggaccttcgttggcacgataaaggttgacaacctcgttgaaaagttc
tacccaaacgtcgagttcttctacttcgttaacgtcgagaagaactacgcggttctaagcccaaaggcgggcttcctatt
cacaactggcaaggacgtgccgaggagcggtgtgcggaaatatgtctggcagggtactaagaagctcgttatctacgatg
agaacggggttatcctcggcattggcaggataaacgcggagagcagaaaaaagttcatcctgaacgttaccgacgttggg
gagttcctgaggcggaagcgc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 263715 - 265215 (Additional range around tg0279 is :500nt.)

>Thermococcus gammatolerans EJ3 CTTCACTGAACCCGTTGGCTTCCGCTGTCTCTACTGCCTCGACTGTTGCAGGGGGAGGCACGTCTACCTCACTCTGAAGG ACGTTGAGCGAATAGCAAAAGCGGGCCACGATCCTCAGGACTTCGTGACGTTCTCGATCGAAGGCGACAAGATACGCTTC GTTCTCGCGATTAGGGAGTGGGATTTGGGTTGCGTCTTCCACGACCCTGAAACCGGGAAGTGCAGGATTCACGCGGTCAG GCCGCTTATATGCCGTATCTACCCCTTCATGGTCTCGCGAAAGCCCCTTGGCGTTAAGAGCGAGAGGCCCTTCCATCACA AAGGCGAAACCCTCTGGCTCTACTACGACGAGAGCTGTCCTGGAATAAACGCCGAAAATCCGGAAACGACGATAACGCCC GAGGAGATAGCCGAACTCGGAATTGAGTTCGAGAGGGAGTTTGAGAAAACCGATATGGACGGCTTTGCAGAGCTGATAGA GCGGCTTGAGGGGGAGAAGG atgagtgagacccttcgctaccgccgtgcctcggcatgggagtacgacctaatcctccg cgaggccgagaagtacggcgagttaaagcaccattttttcgccgtcgttgaaggtaaattcagggacgtttacgccgtca acgagagggtgtgggcggaaatagagaagtttagggtaaagccctacgcctacgggaccttcgttggcacgataaaggtt gacaacctcgttgaaaagttctacccaaacgtcgagttcttctacttcgttaacgtcgagaagaactacgcggttctaag cccaaaggcgggcttcctattcacaactggcaaggacgtgccgaggagcggtgtgcggaaatatgtctggcagggtacta agaagctcgttatctacgatgagaacggggttatcctcggcattggcaggataaacgcggagagcagaaaaaagttcatc ctgaacgttaccgacgttggggagttcctgaggcggaagcgc TAACTTTTCTAACCGGACGTAATCTTTTTAAGACCTT TTGCGTAGAGGTTAATGGTAACTAAAAGTTACTAAAGGGGGTGGCGCTCATGATCAGGAAAGTTAAGACGGGCATCCCTG GCATGGACGAAATCCTTCACGGGGGAATTCCCGAGAGGAACGTCGTCCTGCTCAGCGGTGGACCCGGGACTGGAAAGACC ATATTCAGCCAGCAGTTCCTGTGGAACGGCCTTGGGATGGGCGAGCCCGGCATCTACGTTGCCCTTGAGGAGCACCCAGT TCAGGTAAGGCAGAACATGGCCCAGTTCGGCTGGGACGTGAGGAAGTACGAGGAAGAAGGATTGTTCGCGATGGTCGATG CCTTCACCGCTGGAATCGGCAAGAGCAAGGAGTACGAGAAGTACATCGTTCACGATCTTACGGACATCAGGGAGTTCATA GACGTCCTTAGAACGGCCGTGAAGGACATTGGGGCCAAGCGCGTTGTTATAGACTCGGTTAC