tg0282

Coordinates:266122-266550

>tg0282 S-adenosylmethionine decarboxylase proenzyme (speH)
MSEIETIGFHYVVEAAGCDPEILGNADRIREIFLEAAKVGNMEVKSSYFFKFSPTGVSGVVIVAESHISVHTWPEKGYAA
LDVYTCGTKAEPEKAVDYILEKFRAKYAHVSEIKRGIEEDDDTFTHMIMTWEESLRKNGNGKG

>tg0282 S-adenosylmethionine decarboxylase proenzyme (speH)
atgagcgagattgagaccatcgggttccactacgttgttgaggccgccggttgcgatcctgagatcctcggtaacgctga
caggattagggagatattcctcgaagcggcgaaggtcggcaacatggaggtcaaatccagctatttctttaagttctcac
ctacaggcgtcagtggcgttgtcatcgttgcagaaagtcacatatcagttcacacatggccggagaagggctacgcagct
cttgatgtttacacctgcggaaccaaggctgagcccgagaaggccgttgactacatactcgagaagttcagggccaagta
cgcccacgtctccgagataaagcgcgggatagaagaagacgacgacacgttcacccacatgataatgacctgggaggaga
gcctcagaaagaatggaaacggaaaggga


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 265622 - 267050 (Additional range around tg0282 is :500nt.)

>Thermococcus gammatolerans EJ3 ATGCCCTTCTCTGGGAAGTGAACGGCCAGAATCAAAGCCGCCACTAAAAACACGACGAGCGGATAGAGGACCATTTTTCG CGGTTCCATCCTCACAAGGAAGGAGAGCCGCTTCCGCTTGGTTTCAAGTATTTCGTCGGAAGGTTTCTTCTTAGTTTTCT GTTTCTTGGTTCCCATACCAACACCCCACTGCTCTTTTCCAAAGGGCAGTGATCACTCTCTGAACCACTAGGGATAATGA AGGCCAGCCAGTTTTAAAATTAGTGGTTGCAATCGGCCCGAAAAGAAGGGGCCAAACCCAAAATTGAGCCAAATGGCTGG TAATATTGCCTATTGGTCAGAAACTTCCATTAAATTTCTAAAACTGCCAGAAACTAACAGTTCTATGGATTACCGGCCAG ATCTCAGCCGGTTAAAACCAAAAAAGCCCGCTCAAAACTCTTCAATTTGGGATTAACTTTAAAAAGGGAAGGTCATAGCC TCTCCTCGGGGTGAGAGCC atgagcgagattgagaccatcgggttccactacgttgttgaggccgccggttgcgatcct gagatcctcggtaacgctgacaggattagggagatattcctcgaagcggcgaaggtcggcaacatggaggtcaaatccag ctatttctttaagttctcacctacaggcgtcagtggcgttgtcatcgttgcagaaagtcacatatcagttcacacatggc cggagaagggctacgcagctcttgatgtttacacctgcggaaccaaggctgagcccgagaaggccgttgactacatactc gagaagttcagggccaagtacgcccacgtctccgagataaagcgcgggatagaagaagacgacgacacgttcacccacat gataatgacctgggaggagagcctcagaaagaatggaaacggaaaggga TAAGTCACAGCAGTTTCTCTATTTCCCTTA TCCTTTCGAGGGTATCTCCTAGTATCTTCCTGACGTTCTCAAGCTTCGCCTTGAGCTCCCTGTTCTCCGCTTCAAGGCCC TTGACCTTCTCCTCGAGCTCCTTCACTTTGGCCTCAAGCTCCTCCTTCTCCTTCTTGAGCTTCTCGTACTCCTCGAGGGC GACGAGCTGACCGCCCTTGGCGAGAACCTCAACATTCCTGACGAGCTCGTCCAGCTTGCCCTGTTTTATGAGCTCATAAG TTTCCCTGACGAGCTGTCCTGCTTTTGTCTCGCCCTTGAGGTGCTTCCTGACAGTTGCTTCTGTCCTGCCGAGTTCTTCA GCGATTTCCCTGACGGTCATTCCAGCTTTTTCTCTCGCTATGGCTCCAGCCGCTACCGCGAGGCTGTCAACCCACGTCAG CCTCTCGGCCGGGTCCTTTATGAGCTCTATCACCTCTGGTCTGAAGAGCGTCGCGAAGAGCAGTATGCTC