tg0291

Coordinates:275515-276030

>tg0291 hypothetical protein TGAM_0291
MKVKEIHEFLNRLWDDIFTLNDELKAELTGKGFKVEDVEEVFGAYIFLDGEWVRMDYPHPAFEIKPQIEVGATPESYYFV
VAVPKERISEGFLSLFLELFPRSFIYGSENFLSDVYNWRRDGRVSPREVLERIEGSEEKVFQFEANFGSVEALKKGLERL
IDVGREWEIFDL

>tg0291 hypothetical protein TGAM_0291
atgaaggttaaggaaattcacgagtttctcaacaggctatgggacgacatattcacgctcaacgatgaactcaaagccga
gctgacggggaagggcttcaaggtggaagatgtagaggaggtctttggagcctacatattcctcgacggcgagtgggtca
gaatggactacccccacccggcctttgagataaagcctcaaattgaggtcggggcgacgcctgagagttactacttcgtc
gttgccgttccaaaggagaggataagcgaggggttccttagcctgttccttgaactcttcccaaggagcttcatctatgg
gagcgagaacttcctgagcgacgtctacaactggaggcgcgacggaagggtctcgccgagggaagtccttgagaggattg
aggggagcgaggagaaggtcttccagtttgaggcgaactttggaagtgtagaagcgctcaaaaaaggccttgagaggctg
attgacgttggaagggaatgggaaatcttcgacctt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 275015 - 276530 (Additional range around tg0291 is :500nt.)

>Thermococcus gammatolerans EJ3 ATAGCGGGGCTTTCGATCATCAAGACCCCAGAGCTGAAGGACACAGTGGTAAGGTACCTGGGAAGGGAGGGCAACAAAGC CGTCTTTATGACGGATCTCGTTCTCTACAACCCCAACCCGTACCCATTGCCAATACTTAAAACGAACTATAAGGTGTGGG TGAACGGCCTAAAGCTTGGGGAAGGGGAGTCCCTCAAAACAACGGTCATCCCAGCTGGGGGAACGGTAAAGCTCCCAGTC AAAACGTACGTTCTCGTCTCGAACATCCCAAAGGCATGGGAGATGCACGTGAGGAACAACGAAACGAGCATCGTACGGGC GGAGGTGTTCCTAAGGTTGCAGATATCAGTGCCGGGGTTCTCCGGAACAAAGGATGTAACGCTCAAGACGATTGACCAGA CTGTAAAAACGGACATAATGGGCGAGATAAACCGGGCACTTTCCGAGGTCTGAGCTCAAATTTTTAAACTCCTCTCCCCC TTTTCTTCCGGTGGGAGAG atgaaggttaaggaaattcacgagtttctcaacaggctatgggacgacatattcacgctc aacgatgaactcaaagccgagctgacggggaagggcttcaaggtggaagatgtagaggaggtctttggagcctacatatt cctcgacggcgagtgggtcagaatggactacccccacccggcctttgagataaagcctcaaattgaggtcggggcgacgc ctgagagttactacttcgtcgttgccgttccaaaggagaggataagcgaggggttccttagcctgttccttgaactcttc ccaaggagcttcatctatgggagcgagaacttcctgagcgacgtctacaactggaggcgcgacggaagggtctcgccgag ggaagtccttgagaggattgaggggagcgaggagaaggtcttccagtttgaggcgaactttggaagtgtagaagcgctca aaaaaggccttgagaggctgattgacgttggaagggaatgggaaatcttcgacctt TGAGGCATTTCCGGCGGAGCTCA GGGAGTACTACAGGGAACTCTTCGGGAGTGAGGCAGAGGAGATAATGGCATCGCTCAGAACGCCGGTTGAGAAGTACTAC ATTCGGGTGAACACCCTAAAGACGAGCAGGGACAAGCTGATGCGAATCCTCAGGCGGGAGGGACTAAAGCCGAAGAGGAG CCCCTACCTCAAGGAGGGCATATACTTCGAGAGGGAAGGCCCCAACTTTCCAGACGACTACGAGCCCGGGGTGAAGGTCG TGAGAGCCAACAAGTTCGCGAGCGAGAGCGTCTACCAGGGGGCGAACCTCTACGCGCCGGGAGTCCTTCAGGCAGACAAG AGCATAAGGCCCGGCGACGAGGTCGAGATTAGAGACCCGAGGGGCCTGCTCGTCGGAATCGGGATTGCTAAAATGAGCGC CAAGGAGATGGTAGTTTCGATGAGGGGTTTGGCCGTTGAGGTTACCCTGCCAAAGTTCAGACTCCCAAGTTTAAGTG