tg0313

Coordinates:298241-298918

>tg0313 Triosephosphate isomerase (tpiA)
MTKLKEPIIAINFKTYIEATGKRALAIAKAAEKVYKETGITIVVAPQLADLRMVAESVEIPVFAQHIDPIKPGSHTGHVL
PEAVKEAGAVGTLLNHSENRMILADLEASIRRAEEVGLMTMVCSNNPAVSAAVAALGPDYVAVEPPELIGTGIPVSKAKP
EVITDTVELVKKVNPEVKVLTGAGISTGEDVKKALELGSVGVLLASGVTKAKDPEKAIRDLVSLII

>tg0313 Triosephosphate isomerase (tpiA)
atgacgaagctgaaggaacctattatagcgattaacttcaagacctacatcgaggcaaccggaaagagagctttggcaat
agcgaaggccgctgaaaaggtctacaaagagacggggataaccatagtcgtcgcgccccagctcgccgacctcaggatgg
tagcggagagcgttgagatcccggtcttcgcccagcacatagacccgattaagcccggaagccacaccggtcacgtcctt
cccgaggcagttaaggaagccggggccgttggaaccctcctcaaccactccgagaacaggatgatcttggcggaccttga
ggcgagcattagaagagccgaagaagttggacttatgacgatggtctgctccaacaatccagccgtttcggctgcggtgg
cagctctcggcccagactacgttgccgtcgaaccgccagaacttataggcaccggcatccccgtcagcaaggccaagccg
gaggtcataactgatacagttgagctcgtcaagaaagttaaccctgaggttaaagtcctcactggtgcaggaataagcac
tggcgaggatgtcaagaaggcccttgagctcggaagcgttggagttctgcttgcaagcggtgttaccaaagctaaggatc
ccgagaaggcaataagggacttggtgtccctcatcatc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 297741 - 299418 (Additional range around tg0313 is :500nt.)

>Thermococcus gammatolerans EJ3 TCTCCGCCTTTCCGTTCTGGTGGTAGATCGAGTTCACGATGTCGAGGGGCACCTTGAAGTGGACGTACATCGTGCCCCCC TTGGTGACCTTTACCTTGAACTCATTCGTCCCATTGTATTGCTTCCCGTTGTACTCAACGAGGTACTCGGTTCCTTTGGG AAAGCTCATGCTCAGCTCGAAGTCCTTGACTTTGGGCTTTAGGTCAATCTCGAAGAGGCCCCACCCGTCCTTTTCGACGA AGACCACCGTTGTGTTGTCCTTGTAGAAAACTTCATGGTATGAAACGCTCGCGGGTGGCAGGTGGGCCGTTTTGACGGCG TATCCAAAGAGGGCCAGCGTTACTATGGCCATCACTAACAGCGCTTTGTTCATGACCATCCCCGCTTTATACTGGGCCCG GTGATACTTAACTCTTTTGTGTAGGTTGTTACGATGGGTTGTGGTTATCTCTTGGGAAAGACGTTTAAGGATCAAACCCA TAACACCAACGGTGATACCC atgacgaagctgaaggaacctattatagcgattaacttcaagacctacatcgaggcaac cggaaagagagctttggcaatagcgaaggccgctgaaaaggtctacaaagagacggggataaccatagtcgtcgcgcccc agctcgccgacctcaggatggtagcggagagcgttgagatcccggtcttcgcccagcacatagacccgattaagcccgga agccacaccggtcacgtccttcccgaggcagttaaggaagccggggccgttggaaccctcctcaaccactccgagaacag gatgatcttggcggaccttgaggcgagcattagaagagccgaagaagttggacttatgacgatggtctgctccaacaatc cagccgtttcggctgcggtggcagctctcggcccagactacgttgccgtcgaaccgccagaacttataggcaccggcatc cccgtcagcaaggccaagccggaggtcataactgatacagttgagctcgtcaagaaagttaaccctgaggttaaagtcct cactggtgcaggaataagcactggcgaggatgtcaagaaggcccttgagctcggaagcgttggagttctgcttgcaagcg gtgttaccaaagctaaggatcccgagaaggcaataagggacttggtgtccctcatcatc TGAACTCACGTTTTCTTTTT AAGTCCTTACTCCCTTCTTGAACCGGTGGTAACTATGGCGCTATACTTCATCGGCCTCGGACTATACGATGAGAGGGACA TAACGCTCAAGGGCCTCAAAACGGCCAGGAAATGCGATAAAATCTTCGCCGAGTTCTACACCTCGCTTTTGGCCGGCACA ACTATGGAGAGGATTGAAGGGCTCATAGGAAAGCCGATAATCCGGTTGAGCCGGGAAGATGTCGAGCTGAACTTTGAAAA AATTGTTCTACCTGAGGCCAAGGAGAAAGACGTTGCCTTTCTTACGGCGGGCGATCCAATGGTGGCTACCACTCACTCCG ACCTGAGAATCCGGGCGAAGAAAGCAGGTGTTGAGAGCTACGTAATCCACGCCCCCAGCATATACTCGGCTGTGGCAGTG ACGGGACTTCAGATCTACAAGTTTGGAAAGAGCGCGACCGTCGCTTATCCCGAGAGGAACTGGTTTCCAACGAGCTACT